Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET00FYL) | |||||
|---|---|---|---|---|---|
| Name |
Squalene synthase (FDFT1)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
FPP:FPP farnesyltransferase; Farnesyl-diphosphate farnesyltransferase; Farnesyl-diphosphate farnesyltransferase 1; SQS; SS
|
||||
| Family | Transferase (TFase) >> Alkyl/aryl transferase (EC 2.5) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | FDFT1 | Gene ID | |||
| UniProt ID | FDFT_HUMAN | (click to find more protein-related data of this DBT) | |||
| TTD ID | T81850 | (click to find more therapeutic target data of this DBT) | |||
| INTEDE ID | DME0571 | (click to find more drug-metabolizing enzyme data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MEFVKCLGHPEEFYNLVRFRIGGKRKVMPKMDQDSLSSSLKTCYKYLNQTSRSFAAVIQA
LDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQ VLEDFPTISLEFRNLAEKYQTVIADICRRMGIGMAEFLDKHVTSEQEWDKYCHYVAGLVG IGLSRLFSASEFEDPLVGEDTERANSMGLFLQKTNIIRDYLEDQQGGREFWPQEVWSRYV KKLGDFAKPENIDLAVQCLNELITNALHHIPDVITYLSRLRNQSVFNFCAIPQVMAIATL AACYNNQQVFKGAVKIRKGQAVTLMMDATNMPAVKAIIYQYMEEIYHRIPDSDPSSSKTR QIISTIRTQNLPNCQLISRSHYSPIYLSFVMLLAALSWQYLTTLSQVTEDYVQTGEH |
||||
| Function |
Catalyzes the condensation of 2 farnesyl pyrophosphate (FPP) moieties to form squalene. Proceeds in two distinct steps. In the first half-reaction, two molecules of FPP react to form the stable presqualene diphosphate intermediate (PSQPP), with concomitant release of a proton and a molecule of inorganic diphosphate. In the second half-reaction, PSQPP undergoes heterolysis, isomerization, and reduction with NADPH or NADH to form squalene. It is the first committed enzyme of the sterol biosynthesis pathway.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: Monostearyl citrate | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Emollient
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 9000 nM (estimated based on the structural similarity with CHEMBL78764 ) | [1] | ||||
| Structural Similarity | Tanimoto coefficient = 0.835820896 | |||||
| Tested Species | Rattus norvegicus (Rat) | |||||
| UniProt ID | FDFT_RAT | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Isolation, structure determination and squalene synthase activity of L-731,120 and L-731,128, alkyl citrate analogs of zaragozic acids A and B. Bioorg Med Chem Lett. (1995) 5:2403-2408. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

