General Information of DBT (ID: ET01ZWI)
Name
Solute carrier SLC15A1 (PEPT1)
Synonyms    Click to Show/Hide the Synonyms of This DBT
Intestinal H(+)/peptide cotransporter; Solute carrier family 15 member 1; Oligopeptide transporter, small intestine isoform; PEPT1; Peptide transporter 1
Family Potential-driven transporter (PDT)  >>  Proton-dependent oligopeptide transporter (POT)
Organism
Homo sapiens (Human)
Gene Name SLC15A1 Gene ID
6564
UniProt ID S15A1_HUMAN (click to find more protein-related data of this DBT)
TTD ID T91180 (click to find more therapeutic target data of this DBT)
VARIDT ID DTD0021 (click to find more drug transporter data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MGMSKSHSFFGYPLSIFFIVVNEFCERFSYYGMRAILILYFTNFISWDDNLSTAIYHTFV
ALCYLTPILGALIADSWLGKFKTIVSLSIVYTIGQAVTSVSSINDLTDHNHDGTPDSLPV
HVVLSLIGLALIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIFYLAINAGSLLSTII
TPMLRVQQCGIHSKQACYPLAFGVPAALMAVALIVFVLGSGMYKKFKPQGNIMGKVAKCI
GFAIKNRFRHRSKAFPKREHWLDWAKEKYDERLISQIKMVTRVMFLYIPLPMFWALFDQQ
GSRWTLQATTMSGKIGALEIQPDQMQTVNAILIVIMVPIFDAVLYPLIAKCGFNFTSLKK
MAVGMVLASMAFVVAAIVQVEIDKTLPVFPKGNEVQIKVLNIGNNTMNISLPGEMVTLGP
MSQTNAFMTFDVNKLTRINISSPGSPVTAVTDDFKQGQRHTLLVWAPNHYQVVKDGLNQK
PEKGENGIRFVNTFNELITITMSGKVYANISSYNASTYQFFPSGIKGFTISSTEIPPQCQ
PNFNTFYLEFGSAYTYIVQRKNDSCPEVKVFEDISANTVNMALQIPQYFLLTCGEVVFSV
TGLEFSYSQAPSNMKSVLQAGWLLTVAVGNIIVLIVAGAGQFSKQWAEYILFAALLLVVC
VIFAIMARFYTYINPAEIEAQFDEDEKKNRLEKSNPYFMSGANSQKQM
Function
May constitute a major route for the absorption of protein digestion end-products. Proton-coupled intake of oligopeptides of 2 to 4 amino acids with a preference for dipeptides.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Aceglutamide aluminum Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Other agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 100000 nM (estimated based on the structural similarity with CHEMBL438960 ) [1]
                   Structural Similarity Tanimoto coefficient = 0.835616438
                   Tested Species Homo sapiens (Human)
                   UniProt ID S15A1_HUMAN
          DIG Name: Alitame Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Flavoring agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 310000 nM (estimated based on the structural similarity with CHEMBL441685 ) [1]
                   Structural Similarity Tanimoto coefficient = 0.826666667
                   Tested Species Homo sapiens (Human)
                   UniProt ID S15A1_HUMAN
          DIG Name: Caldiamide sodium Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsion stabilizing agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 480000 nM (estimated based on the structural similarity with CHEMBL292467 ) [1]
                   Structural Similarity Tanimoto coefficient = 0.754716981
                   Tested Species Homo sapiens (Human)
                   UniProt ID S15A1_HUMAN
References
1 Human PEPT1 pharmacophore distinguishes between dipeptide transport and binding. J Med Chem. 2006 Jun 15; 49(12):3636-44.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.