Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET02RTU) | |||||
|---|---|---|---|---|---|
| Name |
Vitamin D3 receptor (VDR)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Nuclear receptor subfamily 1 group I member 1; Nuclear vitamin D receptor; VDR; 1,25-dihydroxyvitamin D3 receptor; NR1I1; Vitamin D(3) receptor
|
||||
| Family | Nuclear receptor (NR) >> Vitamin D receptor (VDR) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | VDR | Gene ID | |||
| UniProt ID | VDR_HUMAN | (click to find more protein-related data of this DBT) | |||
| TTD ID | T34234 | (click to find more therapeutic target data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTC
PFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSL RPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSG DSSSSCSDHCITSSDMMDSSSFSNLDLSEEDSDDPSVTLELSQLSMLPHLADLVSYSIQK VIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRVSDV TKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQDRLS NTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLE VFGNEIS |
||||
| Function |
Enters the nucleus upon vitamin D3 binding where it forms heterodimers with the retinoid X receptor/RXR. The VDR-RXR heterodimers bind to specific response elements on DNA and activate the transcription of vitamin D3-responsive target genes. Plays a central role in calcium homeostasis. Nuclear receptor for calcitriol, the active form of vitamin D3 which mediates the action of this vitamin on cells.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: Sodium desoxycholate | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
 click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Antioxidant; Surfactant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 > 50000 nM (estimated based on the structural similarity with CHEMBL406393 ) | [1] | ||||
| Structural Similarity | Tanimoto coefficient = 1 | |||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | VDR_HUMAN | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Synthesis and evaluation of vitamin D receptor-mediated activities of cholesterol and vitamin D metabolites. Eur J Med Chem. 2016 Feb 15; 109:238-46. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.