Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET02WVL) | |||||
|---|---|---|---|---|---|
| Name |
Intestinal lipid-binding protein (I-FABP)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Fatty acid-binding protein 2; I-FABP; Intestinal-type fatty acid-binding protein; Fatty acid-binding protein, intestinal; FABP2
|
||||
| Family | Other protein families (OPF) >> Fatty acid binding protein (FABP) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | FABP2 | Gene ID | |||
| UniProt ID | FABPI_HUMAN | (click to find more protein-related data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIE
VVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVY EGVEAKRIFKKD |
||||
| Function |
FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis. Binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long-chain fatty acids. FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: Palmitic acid | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
 click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Penetration agent; lubricant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 1700 nM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | FABPI_HUMAN | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Discovery of inhibitors of human adipocyte fatty acid-binding protein, a potential type 2 diabetes target. Bioorg Med Chem Lett. 2004 Sep 6; 14(17):4445-8. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.