Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET03KRU) | |||||
|---|---|---|---|---|---|
| Name |
Glutamate carboxypeptidase II (FOLH1)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Cell growth-inhibiting gene 27 protein; FGCP; FOLH; Folate hydrolase 1; Folylpoly-gamma-glutamate carboxypeptidase; GCPII; GIG27; Glutamate carboxypeptidase 2; Glutamate carboxypeptidase II; MGCP; Membrane glutamate carboxypeptidase; N-acetylated-alpha-linked acidic dipeptidase I; NAALAD1; NAALADase I; PSM; PSMA; Prostate-specific membrane antigen; Pteroylpoly-gamma-glutamate carboxypeptidase
|
||||
| Family | Hydrolase (HDase) >> Peptidase (EC 3.4) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | FOLH1 | Gene ID | |||
| UniProt ID | FOLH1_HUMAN | (click to find more protein-related data of this DBT) | |||
| TTD ID | T97071 | (click to find more therapeutic target data of this DBT) | |||
| INTEDE ID | DME0579 | (click to find more drug-metabolizing enzyme data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKA
FLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYP NKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYA RTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVK SYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYY DAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIG TLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFAS WDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKE LKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKN WETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDY AVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIV LRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVD PSKAWGEVKRQIYVAAFTVQAAAETLSEVA |
||||
| Function |
Has a preference for tri-alpha-glutamate peptides. In the intestine, required for the uptake of folate. In the brain, modulates excitatory neurotransmission through the hydrolysis of the neuropeptide, N-aceylaspartylglutamate (NAAG), thereby releasing glutamate. Involved in prostate tumor progression. Has both folate hydrolase and N-acetylated-alpha-linked-acidic dipeptidase (NAALADase) activity.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: Glutamic acid hydrochloride | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
 click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Acidulant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 428000 nM (estimated based on the structural similarity with CHEMBL575060 ) | [1] | ||||
| Structural Similarity | Tanimoto coefficient = 1 | |||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | FOLH1_HUMAN | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Structural insight into the pharmacophore pocket of human glutamate carboxypeptidase II. J Med Chem. 2007 Jul 12; 50(14):3267-73. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.