Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET03KRU) | |||||
---|---|---|---|---|---|
Name |
Glutamate carboxypeptidase II (FOLH1)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
Cell growth-inhibiting gene 27 protein; FGCP; FOLH; Folate hydrolase 1; Folylpoly-gamma-glutamate carboxypeptidase; GCPII; GIG27; Glutamate carboxypeptidase 2; Glutamate carboxypeptidase II; MGCP; Membrane glutamate carboxypeptidase; N-acetylated-alpha-linked acidic dipeptidase I; NAALAD1; NAALADase I; PSM; PSMA; Prostate-specific membrane antigen; Pteroylpoly-gamma-glutamate carboxypeptidase
|
||||
Family | Hydrolase (HDase) >> Peptidase (EC 3.4) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | FOLH1 | Gene ID | |||
UniProt ID | FOLH1_HUMAN | (click to find more protein-related data of this DBT) | |||
TTD ID | T97071 | (click to find more therapeutic target data of this DBT) | |||
INTEDE ID | DME0579 | (click to find more drug-metabolizing enzyme data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKA
FLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYP NKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYA RTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVK SYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYY DAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIG TLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFAS WDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKE LKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKN WETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDY AVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIV LRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVD PSKAWGEVKRQIYVAAFTVQAAAETLSEVA |
||||
Function |
Has a preference for tri-alpha-glutamate peptides. In the intestine, required for the uptake of folate. In the brain, modulates excitatory neurotransmission through the hydrolysis of the neuropeptide, N-aceylaspartylglutamate (NAAG), thereby releasing glutamate. Involved in prostate tumor progression. Has both folate hydrolase and N-acetylated-alpha-linked-acidic dipeptidase (NAALADase) activity.
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Glutamic acid hydrochloride | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Acidulant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 428000 nM (estimated based on the structural similarity with CHEMBL575060 ) | [1] | ||||
Structural Similarity | Tanimoto coefficient = 1 | |||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | FOLH1_HUMAN | |||||
References | |||||
---|---|---|---|---|---|
1 | Structural insight into the pharmacophore pocket of human glutamate carboxypeptidase II. J Med Chem. 2007 Jul 12; 50(14):3267-73. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.