Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET03NUC) | |||||
---|---|---|---|---|---|
Name |
Vanilloid receptor 2 (TrpV2)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
Transient receptor potential cation channel subfamily V member 2; OTRPC2; Osm-9-like TRP channel 2; Stretch-activated channel 2B; TrpV2; VRL-1; Vanilloid receptor-like protein 1
|
||||
Family | Transmembrane channel/porin (TC/P) >> Transient receptor potential Ca channel (TRP-CC) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | TRPV2 | Gene ID | |||
UniProt ID | TRPV2_HUMAN | (click to find more protein-related data of this DBT) | |||
TTD ID | T82267 | (click to find more therapeutic target data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MTSPSSSPVFRLETLDGGQEDGSEADRGKLDFGSGLPPMESQFQGEDRKFAPQIRVNLNY
RKGTGASQPDPNRFDRDRLFNAVSRGVPEDLAGLPEYLSKTSKYLTDSEYTEGSTGKTCL MKAVLNLKDGVNACILPLLQIDRDSGNPQPLVNAQCTDDYYRGHSALHIAIEKRSLQCVK LLVENGANVHARACGRFFQKGQGTCFYFGELPLSLAACTKQWDVVSYLLENPHQPASLQA TDSQGNTVLHALVMISDNSAENIALVTSMYDGLLQAGARLCPTVQLEDIRNLQDLTPLKL AAKEGKIEIFRHILQREFSGLSHLSRKFTEWCYGPVRVSLYDLASVDSCEENSVLEIIAF HCKSPHRHRMVVLEPLNKLLQAKWDLLIPKFFLNFLCNLIYMFIFTAVAYHQPTLKKQAA PHLKAEVGNSMLLTGHILILLGGIYLLVGQLWYFWRRHVFIWISFIDSYFEILFLFQALL TVVSQVLCFLAIEWYLPLLVSALVLGWLNLLYYTRGFQHTGIYSVMIQKVILRDLLRFLL IYLVFLFGFAVALVSLSQEAWRPEAPTGPNATESVQPMEGQEDEGNGAQYRGILEASLEL FKFTIGMGELAFQEQLHFRGMVLLLLLAYVLLTYILLLNMLIALMSETVNSVATDSWSIW KLQKAISVLEMENGYWWCRKKQRAGVMLTVGTKPDGSPDERWCFRVEEVNWASWEQTLPT LCEDPSGAGVPRTLENPVLASPPKEDEDGASEENYVPVQLLQSN |
||||
Function |
Calcium-permeable, non-selective cation channel with an outward rectification. Seems to be regulated, at least in part, by growth factors, like IGF1, PDGF and morphogenetic neuropeptide/head activator. May transduce physical stimuli in mast cells. Activated by temperatures higher than 52 degrees Celsius; is not activated by vanilloids and acidic pH.
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Oleic acid | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Penetration agent; Solubilizing agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 > 10000 nM (tested by experiment) | [1] | ||||
Tested Species | Rattus norvegicus (Rat) | |||||
UniProt ID | TRPV2_RAT | |||||
DIG Name: Palmitic acid | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Penetration agent; lubricant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 > 10000 nM (tested by experiment) | [1] | ||||
Tested Species | Rattus norvegicus (Rat) | |||||
UniProt ID | TRPV2_RAT | |||||
DIG Name: Sodium stearate | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Gelling agent; Glidant; Modified-release agent; Stiffening agent; lubricant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 > 10000 nM (estimated based on the structural similarity with CHEMBL1173381 ) | [1] | ||||
Structural Similarity | Tanimoto coefficient = 1 | |||||
Tested Species | Rattus norvegicus (Rat) | |||||
UniProt ID | TRPV2_RAT | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.