Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET03PUP)
Name
Glutathione S-transferase P (GSTP1)
Synonyms    Click to Show/Hide the Synonyms of This DBT
Glutathione S transferase P; FAEES3; GST class-pi; GST classpi; GST3; GSTP1-1; GSTP11
Family Transferase (TFase)  >>  Alkyl/aryl transferase (EC 2.5)
Organism
Homo sapiens (Human)
Gene Name GSTP1 Gene ID
2950
UniProt ID GSTP1_HUMAN (click to find more protein-related data of this DBT)
TTD ID T21669 (click to find more therapeutic target data of this DBT)
INTEDE ID DME0088 (click to find more drug-metabolizing enzyme data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGD
LTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYV
KALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAY
VGRLSARPKLKAFLASPEYVNLPINGNGKQ
Function
Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration. Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Alpha-tocopherol Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative; Antioxidant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 500 nM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID GSTP1_HUMAN
References
1 Reviewing Hit Discovery Literature for Difficult Targets: Glutathione Transferase Omega-1 as an Example. J Med Chem. 2018 Sep 13; 61(17):7448-7470.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.