Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET04UQO) | |||||
---|---|---|---|---|---|
Name |
Organic anion transporter 1 (OAT1)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
Solute carrier family 22 member 6; Kidney-specific transport protein; Novel kidney transcript; PAH transporter; Renal organic anion transporter 1; hOAT1; hPAHT; hROAT1; mNKT; mROAT1; SLC22A6
|
||||
Family | Potential-driven transporter (PDT) >> Major facilitator (MF) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | SLC22A6 | Gene ID | |||
UniProt ID | S22A6_HUMAN | (click to find more protein-related data of this DBT) | |||
VARIDT ID | DTD0024 | (click to find more drug transporter data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MAFNDLLQQVGGVGRFQQIQVTLVVLPLLLMASHNTLQNFTAAIPTHHCRPPADANLSKN
GGLEVWLPRDRQGQPESCLRFTSPQWGLPFLNGTEANGTGATEPCTDGWIYDNSTFPSTI VTEWDLVCSHRALRQLAQSLYMVGVLLGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAA FAPNFPIYCAFRLLSGMALAGISLNCMTLNVEWMPIHTRACVGTLIGYVYSLGQFLLAGV AYAVPHWRHLQLLVSAPFFAFFIYSWFFIESARWHSSSGRLDLTLRALQRVARINGKREE GAKLSMEVLRASLQKELTMGKGQASAMELLRCPTLRHLFLCLSMLWFATSFAYYGLVMDL QGFGVSIYLIQVIFGAVDLPAKLVGFLVINSLGRRPAQMAALLLAGICILLNGVIPQDQS IVRTSLAVLGKGCLAASFNCIFLYTGELYPTMIRQTGMGMGSTMARVGSIVSPLVSMTAE LYPSMPLFIYGAVPVAASAVTVLLPETLGQPLPDTVQDLESRWAPTQKEAGIYPRKGKQT RQQQEHQKYMVPLQASAQEKNGL |
||||
Function |
Involved in the renal elimination of endogenous and exogenous organic anions. Functions as organic anion exchanger when the uptake of one molecule of organic anion is coupled with an efflux of one molecule of endogenous dicarboxylic acid (glutarate, ketoglutarate, etc). Mediates the sodium-independent uptake of 2,3-dimercapto-1-propanesulfonic acid (DMPS), cidofovir, adefovir, 9-(2-phosphonylmethoxyethyl) guanine (PMEG), 9-(2-phosphonylmethoxyethyl) diaminopurine (PMEDAP), ochratoxin (OTA).
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Adipic acid | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Acidulant; Buffering agent; Flavoring agent; Modified-release agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Ki = 407.38 nM (tested by experiment) | [1] | ||||
Tested Species | Mus musculus (Mouse) | |||||
UniProt ID | S22A6_MOUSE | |||||
DIG Name: Benzoic acid | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Ki = 251188.64 nM (tested by experiment) | [1] | ||||
Tested Species | Mus musculus (Mouse) | |||||
UniProt ID | S22A6_MOUSE | |||||
DIG Name: D&C red no. 22 | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Colorant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Ki = 89.13 nM (estimated based on the structural similarity with CHEMBL376503 ) | [1] | ||||
Structural Similarity | Tanimoto coefficient = 1 | |||||
Tested Species | Mus musculus (Mouse) | |||||
UniProt ID | S22A6_MOUSE | |||||
DIG Name: D&C red no. 28 | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Colorant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Ki = 0.064 uM (tested by experiment) | [2] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | S22A6_HUMAN | |||||
DIG Name: Sodium stearate | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Gelling agent; Glidant; Modified-release agent; Stiffening agent; lubricant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Ki = 33884.42 nM (estimated based on the structural similarity with CHEMBL1162491 ) | [1] | ||||
Structural Similarity | Tanimoto coefficient = 1 | |||||
Tested Species | Mus musculus (Mouse) | |||||
UniProt ID | S22A6_MOUSE | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.