Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET04VNT) | |||||
---|---|---|---|---|---|
Name |
Glycogen synthase kinase-3 beta (GSK3B)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
Serine/threonine-protein kinase GSK3B; GSK-3 beta
|
||||
Family | Transferase (TFase) >> Kinase (EC 2.7) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | GSK3B | Gene ID | |||
UniProt ID | GSK3B_HUMAN | (click to find more protein-related data of this DBT) | |||
TTD ID | T70977 | (click to find more therapeutic target data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALF NFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST |
||||
Function |
Requires primed phosphorylation of the majority of its substrates. In skeletal muscle, contributes to insulin regulation of glycogen synthesis by phosphorylating and inhibiting GYS1 activity and hence glycogen synthesis. May also mediate the development of insulin resistance by regulating activation of transcription factors. Regulates protein synthesis by controlling the activity of initiation factor 2B (EIF2BE/EIF2B5) in the same manner as glycogen synthase.
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Neohesperidin dihydrochalcone | Click to Show/Hide | |||||
Detailed Information | DIG Info click to show the detail info of this DIG | |||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Flavoring agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 100000 nM (estimated based on the structural similarity with CHEMBL449317 ) | [1] | ||||
Structural Similarity | Tanimoto coefficient = 0.975308642 | |||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | GSK3B_HUMAN | |||||
References | |||||
---|---|---|---|---|---|
1 | Flavonoids as lead compounds modulating the enzyme targets in Alzheimers disease. Med Chem Res (2013) 22:3061-3075. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.