Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET05LUU)
Name
Thiosulfate sulfurtransferase (TST)
Synonyms    Click to Show/Hide the Synonyms of This DBT
Rhodanese; Rhodanase; Thiosulfate sulfurtransferase; Thiosulfate cyanide transsulfurase; Thiosulfate thiotransferase
Family Transferase (TFase)  >>  Sulfotransferase (EC 2.8)
Organism
Homo sapiens (Human)
Gene Name TST Gene ID
7263
UniProt ID THTR_HUMAN (click to find more protein-related data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MVHQVLYRALVSTKWLAESIRTGKLGPGLRVLDASWYSPGTREARKEYLERHVPGASFFD
IEECRDTASPYEMMLPSEAGFAEYVGRLGISNHTHVVVYDGEHLGSFYAPRVWWMFRVFG
HRTVSVLNGGFRNWLKEGHPVTSEPSRPEPAVFKATLDRSLLKTYEQVLENLESKRFQLV
DSRSQGRFLGTEPEPDAVGLDSGHIRGAVNMPFMDFLTEDGFEKGPEELRALFQTKKVDL
SQPLIATCRKGVTACHVALAAYLCGKPDVAVYDGSWSEWFRRAPPESRVSQGKSEKA
Function
Formation of iron-sulfur complexes, cyanide detoxification or modification of sulfur-containing enzymes. Other thiol compounds, besides cyanide, can act as sulfur ion acceptors. Also has weak mercaptopyruvate sulfurtransferase (MST) activity. Together with MRPL18, acts as a mitochondrial import factor for the cytosolic 5S rRNA. Only the nascent unfolded cytoplasmic form is able to bind to the 5S rRNA.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Ascorbyl palmitate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antioxidant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 53000 nM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID THTR_HUMAN
          DIG Name: FD&C red no. 4 Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Colorant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 8700 nM (estimated based on the structural similarity with CHEMBL1200712 ) [1]
                   Structural Similarity Tanimoto coefficient = 0.863387978
                   Tested Species Homo sapiens (Human)
                   UniProt ID THTR_HUMAN
          DIG Name: Riboflavin Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Colorant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 8800 nM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID THTR_HUMAN
          DIG Name: Tannic acid Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antioxidant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 39000 nM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID THTR_HUMAN
          DIG Name: Benzethonium chloride Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative; Surfactant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 > 100000 nM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID THTR_HUMAN
          DIG Name: Cetrimonium bromide Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative; Surfactant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 > 100000 nM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID THTR_HUMAN
References
1 HSP60/10 chaperonin systems are inhibited by a variety of approved drugs, natural products, and known bioactive molecules. Bioorg Med Chem Lett. 2019 May 1; 29(9):1106-1112.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.