Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET05OCC) | |||||
---|---|---|---|---|---|
Name |
Aldehyde dehydrogenase 5A1 (ALDH5A1)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
Aldehyde dehydrogenase family 5 member A1; NAD(+)-dependent succinic semialdehyde dehydrogenase; SSADH; Succinate-semialdehyde dehydrogenase, mitochondrial; Succinic dehydrogenase; Succinate-semialdehyde dehydrogenase
|
||||
Family | Oxidoreductase (ORase) >> Aldehyde/oxo donor oxidoreductase (EC 1.2) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | ALDH5A1 | Gene ID | |||
UniProt ID | SSDH_HUMAN | (click to find more protein-related data of this DBT) | |||
TTD ID | T13259 | (click to find more therapeutic target data of this DBT) | |||
INTEDE ID | DME0214 | (click to find more drug-metabolizing enzyme data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MATCIWLRSCGARRLGSTFPGCRLRPRAGGLVPASGPAPGPAQLRCYAGRLAGLSAALLR
TDSFVGGRWLPAAATFPVQDPASGAALGMVADCGVREARAAVRAAYEAFCRWREVSAKER SSLLRKWYNLMIQNKDDLARIITAESGKPLKEAHGEILYSAFFLEWFSEEARRVYGDIIH TPAKDRRALVLKQPIGVAAVITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSALAL AELASQAGIPSGVYNVIPCSRKNAKEVGEAICTDPLVSKISFTGSTTTGKILLHHAANSV KRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTGQTCVCSNQFLVQRGIHDAFVKAF AEAMKKNLRVGNGFEEGTTQGPLINEKAVEKVEKQVNDAVSKGATVVTGGKRHQLGKNFF EPTLLCNVTQDMLCTHEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQDPAQIWR VAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLELKYVCYGGL |
||||
Function |
Catalyzes one step in the degradation of the inhibitory neurotransmitter gamma-aminobutyric acid (GABA).
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Ethyl vanillin | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Flavoring agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 15600 nM (estimated based on the structural similarity with CHEMBL13883 ) | [1] | ||||
Structural Similarity | Tanimoto coefficient = 0.975806452 | |||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | SSDH_HUMAN | |||||
DIG Name: Vanillin | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Flavoring agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 15600 nM (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | SSDH_HUMAN | |||||
References | |||||
---|---|---|---|---|---|
1 | Inhibition of GABA shunt enzymes' activity by 4-hydroxybenzaldehyde derivatives. Bioorg Med Chem Lett. 2006 Feb; 16(3):592-5. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.