Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET06JLP) | |||||
|---|---|---|---|---|---|
| Name |
Lactoylglutathione lyase (GLO1)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Aldoketomutase; GLO1; Glx I; GlxI; Glyoxalase I; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase
|
||||
| Family | Lyase/isomerase/ligase (L/I/G) >> Carbon-sulfur lyase (EC 4.4) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | GLO1 | Gene ID | |||
| UniProt ID | LGUL_HUMAN | (click to find more protein-related data of this DBT) | |||
| TTD ID | T88285 | (click to find more therapeutic target data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQK
CDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNS DPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKM ATLM |
||||
| Function |
Catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione. Involved in the regulation of TNF-induced transcriptional activity of NF- kappa-B. Required for normal osteoclastogenesis.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: Maltol | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Flavoring agent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Ki = 223872.11 nM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | LGUL_HUMAN | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | The hypothetical active site lattice. An approach to modelling active sites from data on inhibitor molecules. J Med Chem. 1988 Jul; 31(7):1396-406. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

