Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET06MMQ) | |||||
---|---|---|---|---|---|
Name |
Free fatty acid receptor 3 (FFAR3)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
G-protein coupled receptor 41; GPR41
|
||||
Family | G-protein coupled receptor (GPCR) >> G-protein coupled rhodopsin receptor (GPCR-A) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | FFAR3 | Gene ID | |||
UniProt ID | FFAR3_HUMAN | (click to find more protein-related data of this DBT) | |||
TTD ID | T80513 | (click to find more therapeutic target data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MDTGPDQSYFSGNHWFVFSVYLLTFLVGLPLNLLALVVFVGKLQRRPVAVDVLLLNLTAS
DLLLLLFLPFRMVEAANGMHWPLPFILCPLSGFIFFTTIYLTALFLAAVSIERFLSVAHP LWYKTRPRLGQAGLVSVACWLLASAHCSVVYVIEFSGDISHSQGTNGTCYLEFRKDQLAI LLPVRLEMAVVLFVVPLIITSYCYSRLVWILGRGGSHRRQRRVAGLLAATLLNFLVCFGP YNVSHVVGYICGESPAWRIYVTLLSTLNSCVDPFVYYFSSSGFQADFHELLRRLCGLWGQ WQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVACAES |
||||
Function |
G protein-coupled receptor that is activated by a major product of dietary fiber digestion, the short chain fatty acids (SCFAs), and that plays a role in the regulation of whole-body energy homeostasis and in intestinal immunity. In omnivorous mammals, the short chain fatty acids acetate, propionate and butyrate are produced primarily by the gut microbiome that metabolizes dietary fibers. SCFAs serve as a source of energy but also act as signaling molecules.
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Acetic acid | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Acidulant; Buffering agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | EC50 = 12000 nM (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | FFAR3_HUMAN | |||||
DIG Name: Ethyl butyrate | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Flavoring agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | EC50 = 10100 nM (estimated based on the structural similarity with CHEMBL62381 ) | [2] | ||||
Structural Similarity | Tanimoto coefficient = 0.807692308 | |||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | FFAR3_HUMAN | |||||
DIG Name: Potassium acetate | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Film/membrane-forming agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | EC50 = 5000 nM (estimated based on the structural similarity with CHEMBL500826 ) | [3] | ||||
Structural Similarity | Tanimoto coefficient = 0.789473684 | |||||
Tested Species | Rattus norvegicus (Rat) | |||||
UniProt ID | FFAR3_RAT | |||||
DIG Name: Sodium stearate | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Gelling agent; Glidant; Modified-release agent; Stiffening agent; lubricant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | EC50 = 100000 nM (estimated based on the structural similarity with CHEMBL3925414 ) | [3] | ||||
Structural Similarity | Tanimoto coefficient = 1 | |||||
Tested Species | Rattus norvegicus (Rat) | |||||
UniProt ID | FFAR3_RAT | |||||
DIG Name: Acetic anhydride | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Acidulant; Buffering agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | EC50 = 12000 nM (estimated based on the structural similarity with CHEMBL539 ) | [1] | ||||
Structural Similarity | Tanimoto coefficient = 0.761904762 | |||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | FFAR3_HUMAN | |||||
DIG Name: Propionic acid | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Acidulant; Antimicrobial preservative; Antioxidant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | EC50 = 10715.19 nM (tested by experiment) | [4] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | FFAR3_HUMAN | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.