Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET06OZV) | |||||
---|---|---|---|---|---|
Name |
S1P receptor 1 (S1PR1)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
Sphingosine 1-phosphate receptor 1; S1P receptor Edg-1; S1P1; CD363; Endothelial differentiation G-protein coupled receptor 1; Sphingosine 1-phosphate receptor Edg-1
|
||||
Family | G-protein coupled receptor (GPCR) >> G-protein coupled rhodopsin receptor (GPCR-A) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | S1PR1 | Gene ID | |||
UniProt ID | S1PR1_HUMAN | (click to find more protein-related data of this DBT) | |||
TTD ID | T13852 | (click to find more therapeutic target data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFII
LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIM GWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSH PQKDEGDNPETIMSSGNVNSSS |
||||
Function |
G-protein coupled receptor for the bioactive lysosphingolipid sphingosine 1-phosphate (S1P) that seems to be coupled to the G(i) subclass of heteromeric G proteins. Signaling leads to the activation of RAC1, SRC, PTK2/FAK1 and MAP kinases. Plays an important role in cell migration, probably via its role in the reorganization of the actin cytoskeleton and the formation of lamellipodia in response to stimuli that increase the activity of the sphingosine kinase SPHK1.
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Delfen | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Surfactant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | EC50 = 33 nM (estimated based on the structural similarity with CHEMBL228137 ) | [1] | ||||
Structural Similarity | Tanimoto coefficient = 0.894736842 | |||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | S1PR1_HUMAN | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.