Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET07ECZ) | |||||
---|---|---|---|---|---|
Name |
Free fatty acid receptor 2 (FFAR2)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
G-protein coupled receptor 43; Leukocyte-specific STAT-induced GPCR; FFAR2; Gprotein coupled receptor 43
|
||||
Family | G-protein coupled receptor (GPCR) >> G-protein coupled rhodopsin receptor (GPCR-A) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | FFAR2 | Gene ID | |||
UniProt ID | FFAR2_HUMAN | (click to find more protein-related data of this DBT) | |||
TTD ID | T28213 | (click to find more therapeutic target data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MLPDWKSSLILMAYIIIFLTGLPANLLALRAFVGRIRQPQPAPVHILLLSLTLADLLLLL
LLPFKIIEAASNFRWYLPKVVCALTSFGFYSSIYCSTWLLAGISIERYLGVAFPVQYKLS RRPLYGVIAALVAWVMSFGHCTIVIIVQYLNTTEQVRSGNEITCYENFTDNQLDVVLPVR LELCLVLFFIPMAVTIFCYWRFVWIMLSQPLVGAQRRRRAVGLAVVTLLNFLVCFGPYNV SHLVGYHQRKSPWWRSIAVVFSSLNASLDPLLFYFSSSVVRRAFGRGLQVLRNQGSSLLG RRGKDTAEGTNEDRGVGQGEGMPSSDFTTE |
||||
Function |
G protein-coupled receptor that is activated by a major product of dietary fiber digestion, the short chain fatty acids (SCFAs), and that plays a role in the regulation of whole-body energy homeostasis and in intestinal immunity. In omnivorous mammals, the short chain fatty acids acetate, propionate and butyrate are produced primarily by the gut microbiome that metabolizes dietary fibers. SCFAs serve as a source of energy but also act as signaling molecules.
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Acetic acid | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Acidulant; Buffering agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 120000 nM (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | FFAR2_HUMAN | |||||
DIG Name: Ammonium acetate | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Buffering agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | EC50 = 250000 nM (estimated based on the structural similarity with CHEMBL539 ) | [2] | ||||
Structural Similarity | Tanimoto coefficient = 0.8 | |||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | FFAR2_HUMAN | |||||
DIG Name: Propionic acid | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Acidulant; Antimicrobial preservative; Antioxidant
|
|||||
Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 130000 nM (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | FFAR2_HUMAN | |||||
Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | EC50 = 251188.64 nM (tested by experiment) | [3] | ||||
Tested Species | Mus musculus (Mouse) | |||||
UniProt ID | FFAR2_MOUSE | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.