Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET07PQB) | |||||
|---|---|---|---|---|---|
| Name |
Alpha-1A adrenoceptor (ADA1A)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Alpha-1A adrenoreceptor; Alpha-1A adrenoceptor; Alpha-1A adrenergic receptor; Alpha adrenergic receptor 1c; Alpha-adrenergic receptor 1c; Alpha-1C adrenergic receptor; Alpha 1A-adrenoreceptor; Alpha 1A-adrenoceptor; ADRA1C
|
||||
| Family | G-protein coupled receptor (GPCR) >> G-protein coupled rhodopsin receptor (GPCR-A) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | ADRA1A | Gene ID | |||
| UniProt ID | ADA1A_HUMAN | (click to find more protein-related data of this DBT) | |||
| TTD ID | T92609 | (click to find more therapeutic target data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MVFLSGNASDSSNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCII SIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINE EPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN APAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD FKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQSSKHALGYTL HPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCT TARVRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV |
||||
| Function |
Its effect is mediated by G(q) and G(11) proteins. Nuclear ADRA1A-ADRA1B heterooligomers regulate phenylephrine(PE)-stimulated ERK signaling in cardiac myocytes. This alpha-adrenergic receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: Butylparaben | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 16.4 uM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | ADA1A_HUMAN | |||||
| DIG Name: Cetylpyridinium chloride | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative; Penetration agent; Solubilizing agent; Surfactant
|
|||||
| Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | EC50 > 10 uM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | ADA1A_HUMAN | |||||
| Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 6.4 uM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | ADA1A_HUMAN | |||||
| DIG Name: D&C red no. 28 | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Colorant
|
|||||
| Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | EC50 > 3 uM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | ADA1A_HUMAN | |||||
| Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 0.48 uM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | ADA1A_HUMAN | |||||
| DIG Name: Sodium lauryl sulfate | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Modified-release agent; Penetration agent; Solubilizing agent; Surfactant; lubricant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 15 uM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | ADA1A_HUMAN | |||||
| DIG Name: Benzethonium chloride | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative; Surfactant
|
|||||
| Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | EC50 > 10 uM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | ADA1A_HUMAN | |||||
| Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 4.7 uM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | ADA1A_HUMAN | |||||
| DIG Name: Chloroxylenol | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 14.2 uM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | ADA1A_HUMAN | |||||
| DIG Name: Glyceryl laurate | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Emollient; Emulsifying agent; Emulsion stabilizing agent; Solubilizing agent; Surfactant; Viscosity-controlling agent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 6.8 uM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | ADA1A_HUMAN | |||||
| DIG Name: O-tolyl biguanide | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Antioxidant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | EC50 = 5 uM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | ADA1A_HUMAN | |||||
| DIG Name: Phenylmercuric acetate | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | EC50 = 8.7 uM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | ADA1A_HUMAN | |||||
| DIG Name: Thimerosal | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 17 uM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | ADA1A_HUMAN | |||||
| DIG Name: Thymol | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Antioxidant; Flavoring agent; Penetration agent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 26 uM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | ADA1A_HUMAN | |||||
| DIG Name: Butylhydroxyanisole | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative; Antioxidant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 19 uM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | ADA1A_HUMAN | |||||
| DIG Name: FD&C red no. 3 | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Colorant
|
|||||
| Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | EC50 > 0.3 uM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | ADA1A_HUMAN | |||||
| Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 > 0.1 uM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | ADA1A_HUMAN | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | The activities of drug inactive ingredients on biological targets. Science. 2020 Jul 24;369(6502):403-413. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

