General Information of DBT (ID: ET07TAA)
Name
Small CTD phosphatase 1 (CTDSP1)
Synonyms    Click to Show/Hide the Synonyms of This DBT
Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; Nuclear LIM interactor-interacting factor 3; SCP1; Small C-terminal domain phosphatase 1; NLI-IF; NLI-interacting factor 3
Family Hydrolase (HDase)  >>  Ester bond hydrolase (EC 3.1)
Organism
Homo sapiens (Human)
Gene Name CTDSP1 Gene ID
58190
UniProt ID CTDS1_HUMAN (click to find more protein-related data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MDSSAVITQISKEEARGPLRGKGDQKSAASQKPRSRGILHSLFCCVCRDDGEALPAHSGA
PLLVEENGAIPKQTPVQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEI
DGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRES
CVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPF
FEQLSRVDDVYSVLRQPRPGS
Function
Preferentially catalyzes the dephosphorylation of 'Ser-5' within the tandem 7 residue repeats in the C-terminal domain (CTD) of the largest RNA polymerase II subunit POLR2A. Negatively regulates RNA polymerase II transcription, possibly by controlling the transition from initiation/capping to processive transcript elongation. Recruited by REST to neuronal genes that contain RE-1 elements, leading to neuronal gene silencing in non-neuronal cells.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Neohesperidin dihydrochalcone Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Flavoring agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 20733 nM (estimated based on the structural similarity with CHEMBL449317 ) [1]
                   Structural Similarity Tanimoto coefficient = 0.975308642
                   Tested Species Homo sapiens (Human)
                   UniProt ID CTDS1_HUMAN
References
1 PubChem BioAssay data set.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.