Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET07TAA) | |||||
|---|---|---|---|---|---|
| Name |
Small CTD phosphatase 1 (CTDSP1)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; Nuclear LIM interactor-interacting factor 3; SCP1; Small C-terminal domain phosphatase 1; NLI-IF; NLI-interacting factor 3
|
||||
| Family | Hydrolase (HDase) >> Ester bond hydrolase (EC 3.1) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | CTDSP1 | Gene ID | |||
| UniProt ID | CTDS1_HUMAN | (click to find more protein-related data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MDSSAVITQISKEEARGPLRGKGDQKSAASQKPRSRGILHSLFCCVCRDDGEALPAHSGA
PLLVEENGAIPKQTPVQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEI DGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRES CVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPF FEQLSRVDDVYSVLRQPRPGS |
||||
| Function |
Preferentially catalyzes the dephosphorylation of 'Ser-5' within the tandem 7 residue repeats in the C-terminal domain (CTD) of the largest RNA polymerase II subunit POLR2A. Negatively regulates RNA polymerase II transcription, possibly by controlling the transition from initiation/capping to processive transcript elongation. Recruited by REST to neuronal genes that contain RE-1 elements, leading to neuronal gene silencing in non-neuronal cells.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: Neohesperidin dihydrochalcone | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Flavoring agent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 20733 nM (estimated based on the structural similarity with CHEMBL449317 ) | [1] | ||||
| Structural Similarity | Tanimoto coefficient = 0.975308642 | |||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CTDS1_HUMAN | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | PubChem BioAssay data set. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

