Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET08KAW) | |||||
|---|---|---|---|---|---|
| Name |
Factor HNF-4-alpha (HNF4A)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Hepatocyte nuclear factor 4-alpha; HNF-4-alpha; HNF4; NR2A1; Nuclear receptor subfamily 2 group A member 1; TCF-14; TCF14; Transcription factor 14; Transcription factor HNF-4
|
||||
| Family | Nuclear receptor (NR) >> Nuclear hormone receptor (NHR) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | HNF4A | Gene ID | |||
| UniProt ID | HNF4A_HUMAN | (click to find more protein-related data of this DBT) | |||
| TTD ID | T15514 | (click to find more therapeutic target data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSALC
AICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKC FRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQAEVLSRQITSPVSGINGDIRAKK IASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVFK DVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAK GLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKL FGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEW PRPRGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEVI |
||||
| Function |
Activates the transcription of CYP2C38. Represses the CLOCK-ARNTL/BMAL1 transcriptional activity and is essential for circadian rhythm maintenance and period regulation in the liver and colon cells. Transcriptional regulator which controls the expression of hepatic genes during the transition of endodermal cells to hepatic progenitor cells, facilitating the recruitment of RNA pol II to the promoters of target genes.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: Kyselina citronova | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Acidulant; Antioxidant; Buffering agent; Complexing agent; Flavoring agent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 39869 nM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | HNF4A_HUMAN | |||||
| DIG Name: Denatonium benzoate | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Alcohol denaturant; Flavoring agent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 39845 nM (estimated based on the structural similarity with CHEMBL1506851 ) | [1] | ||||
| Structural Similarity | Tanimoto coefficient = 0.875862069 | |||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | HNF4A_HUMAN | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | PubChem BioAssay data set. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

