Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET08ZIK) | |||||
|---|---|---|---|---|---|
| Name |
NFE2-related factor 2 (NRF2)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Nuclear factor erythroid 2-related factor 2; HEBP1; NF-E2-related factor 2; NFE2-related factor 2; NRF2; Nrf-2; Nuclear factor, erythroid derived 2, like 2; NFE2L2
|
||||
| Family | Other protein families (OPF) >> Transcription factor (TF) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | NFE2L2 | Gene ID | |||
| UniProt ID | NF2L2_HUMAN | (click to find more protein-related data of this DBT) | |||
| TTD ID | T88505 | (click to find more therapeutic target data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MMDLELPPPGLPSQQDMDLIDILWRQDIDLGVSREVFDFSQRRKEYELEKQKKLEKERQE
QLQKEQEKAFFAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCM QLLAQTFPFVDDNEVSSATFQSLVPDIPGHIESPVFIATNQAQSPETSVAQVAPVDLDGM QQDIEQVWEELLSIPELQCLNIENDKLVETTMVPSPEAKLTEVDNYHFYSSIPSMEKEVG NCSPHFLNAFEDSFSSILSTEDPNQLTVNSLNSDATVNTDFGDEFYSAFIAEPSISNSMP SPATLSHSLSELLNGPIDVSDLSLCKAFNQNHPESTAEFNDSDSGISLNTSPSVASPEHS VESSSYGDTLLGLSDSEVEELDSAPGSVKQNGPKTPVHSSGDMVQPLSPSQGQSTHVHDA QCENTPEKELPVSPGHRKTPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLPVVD FNEMMSKEQFNEAQLALIRDIRRRGKNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLL KEKGENDKSLHLLKKQLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKP DVKKN |
||||
| Function |
Important for the coordinated up-regulation of genes in response to oxidative stress and the regulation of cellular redox conditions. May be involved in the transcriptional activation of genes of the beta-globin cluster by mediating enhancer activity of hypersensitive site 2 of the beta-globin locus control region. Transcription activator that binds to antioxidant response (ARE) elements in the promoter regions of target genes.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: Ethyl acrylate | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Film/membrane-forming agent; Flavoring agent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | EC50 = 5110 nM (estimated based on the structural similarity with CHEMBL2107333 ) | [1] | ||||
| Structural Similarity | Tanimoto coefficient = 0.837837838 | |||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | NF2L2_HUMAN | |||||
| DIG Name: Tert-Butylhydroquinone | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Antioxidant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | EC50 = 91530 nM (tested by experiment) | [2] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | NF2L2_HUMAN | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

