Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET09FSM) | |||||
|---|---|---|---|---|---|
| Name |
Estradiol 17-beta-dehydrogenase 2 (E2DH)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Microsomal 17-beta-hydroxysteroid dehydrogenase; Short chain dehydrogenase/reductase family 9C member 2; 17-beta-hydroxysteroid dehydrogenase type 2; 17-beta-HSD 2; 20 alpha-hydroxysteroid dehydrogenase; 20-alpha-HSD; E2DH; Testosterone 17-beta-dehydrogenase
|
||||
| Family | Oxidoreductase (ORase) >> CH-OH donor oxidoreductase (EC 1.1) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | HSD17B2 | Gene ID | |||
| UniProt ID | DHB2_HUMAN | (click to find more protein-related data of this DBT) | |||
| INTEDE ID | DME0422 | (click to find more drug-metabolizing enzyme data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLIL
FSVSCFLMYTYLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPG AEELRRTCSPRLSVLQMDITKPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELL LMTDYKQCMAVNFFGTVEVTKTFLPLLRKSKGRLVNVSSMGGGAPMERLASYGSSKAAVT MFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYI LAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICLAHYLPIGIYD YFAKRHFGQDKPMPRALRMPNYKKKAT |
||||
| Function |
Capable of catalyzing the interconversion of testosterone and androstenedione, as well as estradiol and estrone. Also has 20-alpha-HSD activity. Uses NADH while EDH17B3 uses NADPH.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: Ethyl vanillate | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
 click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Flavoring agent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 1280 nM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | DHB2_HUMAN | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Potential Antiosteoporotic Natural Product Lead Compounds That Inhibit 17-Hydroxysteroid Dehydrogenase Type 2. J Nat Prod. 2017 Apr 28; 80(4):965-974. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.