Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET09UIC) | |||||
---|---|---|---|---|---|
Name |
D-amino acid oxidase (DAAO)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
D-amino oxidase; DAMOX; DAAO; DAO
|
||||
Family | Oxidoreductase (ORase) >> CH-NH2 donor oxidoreductase (EC 1.4) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | DAO | Gene ID | |||
UniProt ID | OXDA_HUMAN | (click to find more protein-related data of this DBT) | |||
TTD ID | T33124 | (click to find more therapeutic target data of this DBT) | |||
INTEDE ID | DME0565 | (click to find more drug-metabolizing enzyme data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MRVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYADRFTPLTTTDVAAGLWQPYLSDPN
NPQEADWSQQTFDYLLSHVHSPNAENLGLFLISGYNLFHEAIPDPSWKDTVLGFRKLTPR ELDMFPDYGYGWFHTSLILEGKNYLQWLTERLTERGVKFFQRKVESFEEVAREGADVIVN CTGVWAGALQRDPLLQPGRGQIMKVDAPWMKHFILTHDPERGIYNSPYIIPGTQTVTLGG IFQLGNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERTGFRPVRPQIRLEREQLRTGP SNTEVIHNYGHGGYGLTIHWGCALEAAKLFGRILEEKKLSRMPPSHL |
||||
Function |
Regulates the level of the neuromodulator D-serine in the brain. Has high activity towards D-DOPA and contributes to dopamine synthesis. Could act as a detoxifying agent which removes D-amino acids accumulated during aging. Acts on a variety of D-amino acids with a preference for those having small hydrophobic side chains followed by those bearing polar, aromatic, and basic groups. Does not act on acidic amino acids.
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Benzoic acid | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Ki = 2000 nM (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | OXDA_HUMAN | |||||
DIG Name: Maleic acid | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Acidulant; Buffering agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 357000 nM (estimated based on the structural similarity with CHEMBL1213528 ) | [2] | ||||
Structural Similarity | Tanimoto coefficient = 0.911764706 | |||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | OXDA_HUMAN | |||||
DIG Name: Potassium benzoate | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative; lubricant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 46900 nM (estimated based on the structural similarity with CHEMBL541 ) | [2] | ||||
Structural Similarity | Tanimoto coefficient = 0.941860465 | |||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | OXDA_HUMAN | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.