Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET0A8RI)
Name
Dehydrogenase/reductase 9C 3 (11-DH2)
Synonyms    Click to Show/Hide the Synonyms of This DBT
Corticosteroid 11-beta-dehydrogenase 2; 11 beta-HSD2; 11 beta-hydroxysteroid dehydrogenase type 2; 11-DH2; 11-HSD type II; 11-beta-HSD; 11-beta-HSD type II; 11-beta-HSD2; 11-beta-hydroxysteroid dehydrogenase type 2; 11-beta-hydroxysteroid dehydrogenase type II; HSD11B2; NAD-dependent 11-beta-hydroxysteroid dehydrogenase; Short chain dehydrogenase/reductase family 9C member 3
Family Oxidoreductase (ORase)  >>  CH-OH donor oxidoreductase (EC 1.1)
Organism
Homo sapiens (Human)
Gene Name HSD11B2 Gene ID
3291
UniProt ID DHI2_HUMAN (click to find more protein-related data of this DBT)
TTD ID T43721 (click to find more therapeutic target data of this DBT)
INTEDE ID DME0419 (click to find more drug-metabolizing enzyme data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALAV
LAAAGWIALSRLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPG
AIELRTCCSPRLRLLQMDLTKPGDISRVLEFTKAHTTSTGLWGLVNNAGHNEVVADAELS
PVATFRSCMEVNFFGALELTKGLLPLLRSSRGRIVTVGSPAGDMPYPCLGAYGTSKAAVA
LLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRKQLLLANLPQELLQAYGKDYI
EHLHGQFLHSLRLAMSDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRR
RFLQAFFISHCLPRALQPGQPGTTPPQDAAQDPNLSPGPSPAVAR
Function
Catalyzes the conversion of cortisol to the inactive metabolite cortisone. modulates intracellular glucocorticoid levels, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Monoammonium glycyrrhizate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Flavoring agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 0.4 nM (estimated based on the structural similarity with CHEMBL441687 ) [1]
                   Structural Similarity Tanimoto coefficient = 0.982905983
                   Tested Species Homo sapiens (Human)
                   UniProt ID DHI2_HUMAN
          DIG Name: Glycyrrhizin Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Flavoring agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 0.4 nM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID DHI2_HUMAN
References
1 Cycloartane and friedelane triterpenoids from the leaves of Caloncoba glauca and their evaluation for inhibition of 11-hydroxysteroid dehydrogenases. J Nat Prod. 2012 Apr 27; 75(4):599-604.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.