Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET0AD9J) | |||||
|---|---|---|---|---|---|
| Name |
GABA(A) receptor rho-1 (GABRR1)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
GABA(A) receptor subunit rho-1; GABA(C) receptor; GABA(C) receptor1; Gamma-aminobutyric acid receptor subunit rho-1
|
||||
| Family | Transmembrane channel/porin (TC/P) >> Ligand-gated ion channel (LIC) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | GABRR1 | Gene ID | |||
| UniProt ID | GBRR1_HUMAN | (click to find more protein-related data of this DBT) | |||
| TTD ID | T99665 | (click to find more therapeutic target data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MLAVPNMRFGIFLLWWGWVLATESRMHWPGREVHEMSKKGRPQRQRREVHEDAHKQVSPI
LRRSPDITKSPLTKSEQLLRIDDHDFSMRPGFGGPAIPVGVDVQVESLDSISEVDMDFTM TLYLRHYWKDERLSFPSTNNLSMTFDGRLVKKIWVPDMFFVHSKRSFIHDTTTDNVMLRV QPDGKVLYSLRVTVTAMCNMDFSRFPLDTQTCSLEIESYAYTEDDLMLYWKKGNDSLKTD ERISLSQFLIQEFHTTTKLAFYSSTGWYNRLYINFTLRRHIFFFLLQTYFPATLMVMLSW VSFWIDRRAVPARVPLGITTVLTMSTIITGVNASMPRVSYIKAVDIYLWVSFVFVFLSVL EYAAVNYLTTVQERKEQKLREKLPCTSGLPPPRTAMLDGNYSDGEVNDLDNYMPENGEKP DRMMVQLTLASERSSPQRKSQRSSYVSMRIDTHAIDKYSRIIFPAAYILFNLIYWSIFS |
||||
| Function |
GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel. Rho-1 GABA receptor could play a role in retinal neurotransmission.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: Taurine | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
 click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Buffering agent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | EC50 = 4600 nM (estimated based on the structural similarity with CHEMBL32102 ) | [1] | ||||
| Structural Similarity | Tanimoto coefficient = 0.903225806 | |||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | GBRR1_HUMAN | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | GABA-Activated ligand gated ion channels: medicinal chemistry and molecular biology. J Med Chem. 2000 Apr 20; 43(8):1427-47. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.