Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET0AX5F) | |||||
|---|---|---|---|---|---|
| Name |
Dehydrogenase/reductase 26C 1 (11-DH)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Corticosteroid 11-beta-dehydrogenase 1; 11 beta-hydroxysteroid dehydrogenase type 1; 11-DH; 11-beta-HSD1; 11-beta-hydroxysteroid dehydrogenase 1; 11HSD1; 11beta-HSD1A; HSD11B1; Short chain dehydrogenase/reductase family 26C member 1
|
||||
| Family | Oxidoreductase (ORase) >> CH-OH donor oxidoreductase (EC 1.1) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | HSD11B1 | Gene ID | |||
| UniProt ID | DHI1_HUMAN | (click to find more protein-related data of this DBT) | |||
| TTD ID | T65200 | (click to find more therapeutic target data of this DBT) | |||
| INTEDE ID | DME0199 | (click to find more drug-metabolizing enzyme data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAH
VVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNH ITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMV AAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEE CALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK |
||||
| Function |
Catalyzes reversibly the conversion of cortisol to the inactive metabolite cortisone. Catalyzes reversibly the conversion of 7-ketocholesterol to 7-beta-hydroxycholesterol. In intact cells, the reaction runs only in one direction, from 7-ketocholesterol to 7-beta-hydroxycholesterol.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: Monoammonium glycyrrhizate | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Flavoring agent
|
|||||
| Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | EC50 = 10 nM (estimated based on the structural similarity with CHEMBL441687 ) | [1] | ||||
| Structural Similarity | Tanimoto coefficient = 0.982905983 | |||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | DHI1_HUMAN | |||||
| Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | EC50 = 8 nM (estimated based on the structural similarity with CHEMBL441687 ) | [1] | ||||
| Structural Similarity | Tanimoto coefficient = 0.982905983 | |||||
| Tested Species | Mus musculus (Mouse) | |||||
| UniProt ID | DHI1_MOUSE | |||||
| DIG Name: Glycyrrhizin | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Flavoring agent
|
|||||
| Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 6 nM (tested by experiment) | [2] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | DHI1_HUMAN | |||||
| Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 3 nM (tested by experiment) | [2] | ||||
| Tested Species | Mus musculus (Mouse) | |||||
| UniProt ID | DHI1_MOUSE | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

