Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET0CL6Y)
Name
Noradrenaline N-methyltransferase (PNMT)
Synonyms    Click to Show/Hide the Synonyms of This DBT
Phenylethanolamine N-methyltransferase; PNMTase; PENT; PNMT
Family Transferase (TFase)  >>  Methylase (EC 2.1)
Organism
Homo sapiens (Human)
Gene Name PNMT Gene ID
5409
UniProt ID PNMT_HUMAN (click to find more protein-related data of this DBT)
TTD ID T56496 (click to find more therapeutic target data of this DBT)
INTEDE ID DME0543 (click to find more drug-metabolizing enzyme data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRC
LAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGA
FNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVS
AFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVR
EALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKVGL
Function
Converts noradrenaline to adrenaline.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Monoethanolamine lauryl sulfate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Surfactant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 109000 nM (estimated based on the structural similarity with CHEMBL18542 ) [1]
                   Structural Similarity Tanimoto coefficient = 0.76
                   Tested Species Bos taurus (Bovine)
                   UniProt ID PNMT_BOVIN
          DIG Name: Glutaral Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 345000 nM (estimated based on the structural similarity with CHEMBL18602 ) [1]
                   Structural Similarity Tanimoto coefficient = 0.88
                   Tested Species Bos taurus (Bovine)
                   UniProt ID PNMT_BOVIN
References
1 Importance of the aromatic ring in adrenergic amines. 5. Nonaromatic analogues of phenylethanolamine as inhibitors of phenylethanolamine N-methyltransferase: role of hydrophobic and steric interactions. J Med Chem. 1981 Jan; 24(1):7-12.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.