Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET0E9KS) | |||||
|---|---|---|---|---|---|
| Name |
Pancreatic alpha-amylase (AMYP)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Alpha-D-glucan glucanohydrolase; PA; 1,4-alpha-D-glucan glucanohydrolase
|
||||
| Family | Hydrolase (HDase) >> Glycosylase (EC 3.2) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | AMY2A | Gene ID | |||
| UniProt ID | AMYP_HUMAN | (click to find more protein-related data of this DBT) | |||
| TTD ID | T86918 | (click to find more therapeutic target data of this DBT) | |||
| INTEDE ID | DME0148 | (click to find more drug-metabolizing enzyme data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MKFFLLLFTIGFCWAQYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPP
NENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGN AVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGL LDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAG SKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWG FVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWP RQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQP FTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGI KIYVSDDGKAHFSISNSAEDPFIAIHAESKL |
||||
| Function |
The two forms of this enzyme, I and II, show very similar activities, molecular masses, and compositions and differ only in their isoelectric points. As no evidence for two variants were in the cDNA library, it is most likely that isoform I (PPAI) and isoform II (PPAII) are two forms of the same protein.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: Glycyrrhizin | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Flavoring agent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 > 200000 nM (tested by experiment) | [1] | ||||
| Tested Species | Sus scrofa (Pig) | |||||
| UniProt ID | AMYP_PIG | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Pentacyclic triterpenes as -glucosidase and -amylase inhibitors: Structure-activity relationships and the synergism with acarbose. Bioorg Med Chem Lett. 2017 Nov 15; 27(22):5065-5070. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

