Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET0ES2F) | |||||
|---|---|---|---|---|---|
| Name |
Guanine-binding G(i) alpha-3 (GNAI3)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Guanine nucleotide-binding protein G(i) subunit alpha-3; G(i) alpha-3
|
||||
| Family | Other protein families (OPF) >> G-alpha protein (GAP) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | GNAI3 | Gene ID | |||
| UniProt ID | GNAI3_HUMAN | (click to find more protein-related data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMT PELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQSNYIPTQQDVLRTRVK TTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM NRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAA AYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY |
||||
| Function |
Heterotrimeric guanine nucleotide-binding proteins (G proteins) function as transducers downstream of G protein-coupled receptors (GPCRs) in numerous signaling cascades. The alpha chain contains the guanine nucleotide binding site and alternates between an active, GTP-bound state and an inactive, GDP-bound state. Signaling by an activated GPCR promotes GDP release and GTP binding. The alpha subunit has a low GTPase activity that converts bound GTP to GDP, thereby terminating the signal.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: Hexetidine | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | EC50 = 23000 nM (estimated based on the structural similarity with CHEMBL541892 ) | [1] | ||||
| Structural Similarity | Tanimoto coefficient = 0.79245283 | |||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | GNAI3_HUMAN | |||||
| DIG Name: Stearic hydrazide | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Emulsifying agent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | EC50 = 24900 nM (estimated based on the structural similarity with CHEMBL3215538 ) | [1] | ||||
| Structural Similarity | Tanimoto coefficient = 0.75 | |||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | GNAI3_HUMAN | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Design, synthesis, and preliminary pharmacological evaluation of a set of small molecules that directly activate gi proteins. J Med Chem. 2005 Oct 6; 48(20):6491-503. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

