General Information of DBT (ID: ET0ES2F)
Name
Guanine-binding G(i) alpha-3 (GNAI3)
Synonyms    Click to Show/Hide the Synonyms of This DBT
Guanine nucleotide-binding protein G(i) subunit alpha-3; G(i) alpha-3
Family Other protein families (OPF)  >>  G-alpha protein (GAP)
Organism
Homo sapiens (Human)
Gene Name GNAI3 Gene ID
2773
UniProt ID GNAI3_HUMAN (click to find more protein-related data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMT
PELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQSNYIPTQQDVLRTRVK
TTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAA
AYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY
Function
Heterotrimeric guanine nucleotide-binding proteins (G proteins) function as transducers downstream of G protein-coupled receptors (GPCRs) in numerous signaling cascades. The alpha chain contains the guanine nucleotide binding site and alternates between an active, GTP-bound state and an inactive, GDP-bound state. Signaling by an activated GPCR promotes GDP release and GTP binding. The alpha subunit has a low GTPase activity that converts bound GTP to GDP, thereby terminating the signal.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Hexetidine Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 23000 nM (estimated based on the structural similarity with CHEMBL541892 ) [1]
                   Structural Similarity Tanimoto coefficient = 0.79245283
                   Tested Species Homo sapiens (Human)
                   UniProt ID GNAI3_HUMAN
          DIG Name: Stearic hydrazide Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 24900 nM (estimated based on the structural similarity with CHEMBL3215538 ) [1]
                   Structural Similarity Tanimoto coefficient = 0.75
                   Tested Species Homo sapiens (Human)
                   UniProt ID GNAI3_HUMAN
References
1 Design, synthesis, and preliminary pharmacological evaluation of a set of small molecules that directly activate gi proteins. J Med Chem. 2005 Oct 6; 48(20):6491-503.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.