Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET0F0PP) | |||||
|---|---|---|---|---|---|
| Name |
P2Y purinoceptor 2 (P2RY2)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Adenosine P2Y2 receptor; P2RY2; P2U nucleotide receptor; P2U purinoceptor 1; P2U receptor; P2U receptor 1; P2U1; P2Y2; ATP receptor; Purinergic receptor
|
||||
| Family | G-protein coupled receptor (GPCR) >> G-protein coupled rhodopsin receptor (GPCR-A) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | P2RY2 | Gene ID | |||
| UniProt ID | P2RY2_HUMAN | (click to find more protein-related data of this DBT) | |||
| TTD ID | T93515 | (click to find more therapeutic target data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MAADLGPWNDTINGTWDGDELGYRCRFNEDFKYVLLPVSYGVVCVPGLCLNAVALYIFLC
RLKTWNASTTYMFHLAVSDALYAASLPLLVYYYARGDHWPFSTVLCKLVRFLFYTNLYCS ILFLTCISVHRCLGVLRPLRSLRWGRARYARRVAGAVWVLVLACQAPVLYFVTTSARGGR VTCHDTSAPELFSRFVAYSSVMLGLLFAVPFAVILVCYVLMARRLLKPAYGTSGGLPRAK RKSVRTIAVVLAVFALCFLPFHVTRTLYYSFRSLDLSCHTLNAINMAYKVTRPLASANSC LDPVLYFLAGQRLVRFARDAKPPTGPSPATPARRRLGLRRSDRTDMQRIEDVLGSSEDSR RTESTPAGSENTKDIRL |
||||
| Function |
Receptor for ATP and UTP coupled to G-proteins thatactivate a phosphatidylinositol-calcium second messenger system. The affinity range is UTP = ATP > ATP-gamma-S >> 2-methylthio-ATP = ADP.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: D&C green no. 5 | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Colorant
|
|||||
| Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 3930 nM (estimated based on the structural similarity with CHEMBL401859 ) | [1] | ||||
| Structural Similarity | Tanimoto coefficient = 0.934131737 | |||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | P2RY2_HUMAN | |||||
| Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 30000 nM (estimated based on the structural similarity with CHEMBL401859 ) | [1] | ||||
| Structural Similarity | Tanimoto coefficient = 0.934131737 | |||||
| Tested Species | Mus musculus (Mouse) | |||||
| UniProt ID | P2RY2_MOUSE | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Combinatorial synthesis of anilinoanthraquinone derivatives and evaluation as non-nucleotide-derived P2Y2 receptor antagonists. Bioorg Med Chem Lett. 2008 Jan 1; 18(1):223-7. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

