Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET0G4NF) | |||||
---|---|---|---|---|---|
Name |
Riboflavin-binding protein (RTBDN)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
Retbindin; Riboflavin-binding protein, plasma form; Riboflavin-binding protein, yolk major form; RBP; Riboflavin-binding protein, yolk minor form
|
||||
Family | Other protein families (OPF) >> Folate receptor (FR) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | RTBDN | Gene ID | |||
UniProt ID | RTBDN_HUMAN | (click to find more protein-related data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MDCRVHMRPIGLTWVLQLTLAWILLEACGGSRPLQARSQQHHGLAADLGKGKLHLAGPCC
PSEMDTTETSGPGNHPERCGVPSPECESFLEHLQRALRSRFRLRLLGVRQAQPLCEELCQ AWFANCEDDITCGPTWLPLSEKRGCEPSCLTYGQTFADGTDLCRSALGHALPVAAPGARH CFNISISAVPRPRPGRRGREAPSRRSRSPRTSILDAAGSGSGSGSGSGP |
||||
Function |
Required for the transport of riboflavin to the developing oocyte.
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Riboflavin | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Colorant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Ki = 350 nM (tested by experiment) | [1] | ||||
Tested Species | Gallus gallus (Chicken) | |||||
UniProt ID | RBP_CHICK | |||||
References | |||||
---|---|---|---|---|---|
1 | Bioanalytical Screening of Riboflavin Antagonists for Targeted Drug Delivery - A Thermodynamic and Kinetic Study. ACS Med Chem Lett. 2011 May 12; 2(5):363-367. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.