Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET0G4NF) | |||||
|---|---|---|---|---|---|
| Name |
Riboflavin-binding protein (RTBDN)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Retbindin; Riboflavin-binding protein, plasma form; Riboflavin-binding protein, yolk major form; RBP; Riboflavin-binding protein, yolk minor form
|
||||
| Family | Other protein families (OPF) >> Folate receptor (FR) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | RTBDN | Gene ID | |||
| UniProt ID | RTBDN_HUMAN | (click to find more protein-related data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MDCRVHMRPIGLTWVLQLTLAWILLEACGGSRPLQARSQQHHGLAADLGKGKLHLAGPCC
PSEMDTTETSGPGNHPERCGVPSPECESFLEHLQRALRSRFRLRLLGVRQAQPLCEELCQ AWFANCEDDITCGPTWLPLSEKRGCEPSCLTYGQTFADGTDLCRSALGHALPVAAPGARH CFNISISAVPRPRPGRRGREAPSRRSRSPRTSILDAAGSGSGSGSGSGP |
||||
| Function |
Required for the transport of riboflavin to the developing oocyte.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: Riboflavin | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
 click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Colorant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Ki = 350 nM (tested by experiment) | [1] | ||||
| Tested Species | Gallus gallus (Chicken) | |||||
| UniProt ID | RBP_CHICK | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Bioanalytical Screening of Riboflavin Antagonists for Targeted Drug Delivery - A Thermodynamic and Kinetic Study. ACS Med Chem Lett. 2011 May 12; 2(5):363-367. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.