Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET0H5PN) | |||||
|---|---|---|---|---|---|
| Name |
Thioredoxin reductase TR1 (TXNRD1)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Cytoplasmic thioredoxin reductase; GRIM-12; GRIM12; Gene associated with retinoic and IFN-induced mortality 12 protein; Gene associated with retinoic and interferon-induced mortality 12 protein; KDRF; KM-102-derived reductase-like factor; TR; Thioredoxin reductase 1, cytoplasmic; Thioredoxin reductase TR1
|
||||
| Family | Oxidoreductase (ORase) >> Sulfur donor oxidoreductase (EC 1.8) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | TXNRD1 | Gene ID | |||
| UniProt ID | TRXR1_HUMAN | (click to find more protein-related data of this DBT) | |||
| TTD ID | T84581 | (click to find more therapeutic target data of this DBT) | |||
| INTEDE ID | DME0210 | (click to find more drug-metabolizing enzyme data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MGCAEGKAVAAAAPTELQTKGKNGDGRRRSAKDHHPGKTLPENPAGFTSTATADSRALLQ
AYIDGHSVVIFSRSTCTRCTEVKKLFKSLCVPYFVLELDQTEDGRALEGTLSELAAETDL PVVFVKQRKIGGHGPTLKAYQEGRLQKLLKMNGPEDLPKSYDYDLIIIGGGSGGLAAAKE AAQYGKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKV EETVKHDWDRMIEAVQNHIGSLNWGYRVALREKKVVYENAYGQFIGPHRIKATNNKGKEK IYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLA GIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVV AQSTNSEEIIEGEYNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIY AIGDILEDKVELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKA VEKFGEENIEVYHSYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQ GFAAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTKRSGASILQAGCUG |
||||
| Function |
Isoform 1 may possess glutaredoxin activity as well as thioredoxin reductase activity and induces actin and tubulin polymerization, leading to formation of cell membrane protrusions. Isoform 4 enhances the transcriptional activity of estrogen receptors alpha and beta while isoform 5 enhances the transcriptional activity of the beta receptor only. Isoform 5 also mediates cell death induced by a combination of interferon-beta and retinoic acid.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: Methylene blue | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
 click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Colorant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 30000 nM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | TRXR1_HUMAN | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Interactions of methylene blue with human disulfide reductases and their orthologues from Plasmodium falciparum. Antimicrob Agents Chemother. 2008 Jan; 52(1):183-91. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.