Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET0HC2E) | |||||
|---|---|---|---|---|---|
| Name |
Solute carrier SLC47A2 (MATE2)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Solute carrier family 47 member 2; Kidney-specific H(+)/organic cation antiporter; MATE-2; MATE2; Multidrug and toxin extrusion protein 2; hMATE-2
|
||||
| Family | Potential-driven transporter (PDT) >> Multidrug/oligosaccharidyl-lipid/polysaccharide flippase (MOPF) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | SLC47A2 | Gene ID | |||
| UniProt ID | S47A2_HUMAN | (click to find more protein-related data of this DBT) | |||
| TTD ID | T78127 | (click to find more therapeutic target data of this DBT) | |||
| VARIDT ID | DTD0028 | (click to find more drug transporter data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MDSLQDTVALDHGGCCPALSRLVPRGFGTEMWTLFALSGPLFLFQVLTFMIYIVSTVFCG
HLGKVELASVTLAVAFVNVCGVSVGVGLSSACDTLMSQSFGSPNKKHVGVILQRGALVLL LCCLPCWALFLNTQHILLLFRQDPDVSRLTQDYVMIFIPGLPVIFLYNLLAKYLQNQGWL KGQEEESPFQTPGLSILHPSHSHLSRASFHLFQKITWPQVLSGVVGNCVNGVANYALVSV LNLGVRGSAYANIISQFAQTVFLLLYIVLKKLHLETWAGWSSQCLQDWGPFFSLAVPSML MICVEWWAYEIGSFLMGLLSVVDLSAQAVIYEVATVTYMIPLGLSIGVCVRVGMALGAAD TVQAKRSAVSGVLSIVGISLVLGTLISILKNQLGHIFTNDEDVIALVSQVLPVYSVFHVF EAICCVYGGVLRGTGKQAFGAAVNAITYYIIGLPLGILLTFVVRMRIMGLWLGMLACVFL ATAAFVAYTARLDWKLAAEEAKKHSGRQQQQRAESTATRPGPEKAVLSSVATGSSPGITL TTYSRSECHVDFFRTPEEAHALSAPTSRLSVKQLVIRRGAALGAASATLMVGLTVRILAT RH |
||||
| Function |
Solute transporter for tetraethylammonium (TEA), 1-methyl-4-phenylpyridinium (MPP), cimetidine, N-methylnicotinamide, metformin, creatinine, guanidine, procainamide, topotecan, estrone sulfate, acyclovir, and ganciclovir. Responsible for the secretion of cationic drugs across the brush border membranes.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: Chlorhexidine | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 500 nM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | S47A2_HUMAN | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

