Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET0HS3D) | |||||
---|---|---|---|---|---|
Name |
Perilipin-1 (PLIN1)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
Lipid droplet-associated protein; PERI; PLIN1
|
||||
Family | Other protein families (OPF) >> Perilipin (PL) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | PLIN1 | Gene ID | |||
UniProt ID | PLIN1_HUMAN | (click to find more protein-related data of this DBT) | |||
TTD ID | T97897 | (click to find more therapeutic target data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MAVNKGLTLLDGDLPEQENVLQRVLQLPVVSGTCECFQKTYTSTKEAHPLVASVCNAYEK
GVQSASSLAAWSMEPVVRRLSTQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTI STRLRSARNSISVPIASTSDKVLGAALAGCELAWGVARDTAEFAANTRAGRLASGGADLA LGSIEKVVEYLLPPDKEESAPAPGHQQAQKSPKAKPSLLSRVGALTNTLSRYTVQTMARA LEQGHTVAMWIPGVVPLSSLAQWGASVAMQAVSRRRSEVRVPWLHSLAAAQEEDHEDQTD TEGEDTEEEEELETEENKFSEVAALPGPRGLLGGVAHTLQKTLQTTISAVTWAPAAVLGM AGRVLHLTPAPAVSSTKGRAMSLSDALKGVTDNVVDTVVHYVPLPRLSLMEPESEFRDID NPPAEVERREAERRASGAPSAGPEPAPRLAQPRRSLRSAQSPGAPPGPGLEDEVATPAAP RPGFPAVPREKPKRRVSDSFFRPSVMEPILGRTHYSQLRKKS |
||||
Function |
Modulator of adipocyte lipid metabolism. Coats lipid storage droplets to protect them from breakdown by hormone- sensitive lipase (HSL). Its absence may result in leanness. Plays a role in unilocular lipid droplet formation by activating CIDEC. Their interaction promotes lipid droplet enlargement and directional net neutral lipid transfer. May modulate lipolysis and triglyceride levels.
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Kyselina citronova | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Acidulant; Antioxidant; Buffering agent; Complexing agent; Flavoring agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 3708 nM (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | PLIN1_HUMAN | |||||
References | |||||
---|---|---|---|---|---|
1 | PubChem BioAssay data set. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.