Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET0I5TB)
Name
Carbonic anhydrase III (CA3)
Synonyms    Click to Show/Hide the Synonyms of This DBT
Carbonate dehydratase III; Carbonic anhydrase 3; CA-III
Family Lyase/isomerase/ligase (L/I/G)  >>  Carbon-oxygen lyase (EC 4.2)
Organism
Homo sapiens (Human)
Gene Name CA3 Gene ID
761
UniProt ID CAH3_HUMAN (click to find more protein-related data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTIL
NNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHL
VHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDP
SCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPL
VSNWRPPQPINNRVVRASFK
Function
Reversible hydration of carbon dioxide.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Hydroquinone Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antioxidant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 8200 nM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CAH3_HUMAN
          DIG Name: Phenol Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 2700 nM (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CAH3_HUMAN
References
1 Carbonic anhydrase inhibitors: inhibition of mammalian isoforms I-XIV with a series of substituted phenols including paracetamol and salicylic acid. Bioorg Med Chem. 2008 Aug 1; 16(15):7424-8.
2 Synthesis of C-cinnamoyl glycosides and their inhibitory activity against mammalian carbonic anhydrases. Bioorg Med Chem. 2013 Mar 15; 21(6):1489-94.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.