Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET0JU3C) | |||||
|---|---|---|---|---|---|
| Name |
Cytochrome P450 1B1 (CYP1B1)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Cytochrome P450 CYPIB1; Hydroperoxy icosatetraenoate dehydratase CYPIB1; CYPIB1
|
||||
| Family | Lyase/isomerase/ligase (L/I/G) >> Carbon-oxygen lyase (EC 4.2) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | CYP1B1 | Gene ID | |||
| UniProt ID | CP1B1_HUMAN | (click to find more protein-related data of this DBT) | |||
| TTD ID | T92521 | (click to find more therapeutic target data of this DBT) | |||
| INTEDE ID | DME0023 | (click to find more drug-metabolizing enzyme data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MGTSLSPNDPWPLNPLSIQQTTLLLLLSVLATVHVGQRLLRQRRRQLRSAPPGPFAWPLI
GNAAAVGQAAHLSFARLARRYGDVFQIRLGSCPIVVLNGERAIHQALVQQGSAFADRPAF ASFRVVSGGRSMAFGHYSEHWKVQRRAAHSMMRNFFTRQPRSRQVLEGHVLSEARELVAL LVRGSADGAFLDPRPLTVVAVANVMSAVCFGCRYSHDDPEFRELLSHNEEFGRTVGAGSL VDVMPWLQYFPNPVRTVFREFEQLNRNFSNFILDKFLRHCESLRPGAAPRDMMDAFILSA EKKAAGDSHGGGARLDLENVPATITDIFGASQDTLSTALQWLLLLFTRYPDVQTRVQAEL DQVVGRDRLPCMGDQPNLPYVLAFLYEAMRFSSFVPVTIPHATTANTSVLGYHIPKDTVV FVNQWSVNHDPLKWPNPENFDPARFLDKDGLINKDLTSRVMIFSVGKRRCIGEELSKMQL FLFISILAHQCDFRANPNEPAKMNFSYGLTIKPKSFKVNVTLRESMELLDSAVQNLQAKE TCQ |
||||
| Function |
In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, retinoid and xenobiotics. Preferentially oxidizes 17beta-estradiol to the carcinogenic 4-hydroxy derivative, and a variety of procarcinogenic compounds to their activated forms, including polycyclic aromatic hydrocarbons. Promotes angiogenesis by removing cellular oxygenation products, thereby decreasing oxidative stress.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: Aminobenzoic acid | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
 click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Antioxidant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 > 120000 nM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP1B1_HUMAN | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Aryl morpholino triazenes inhibit cytochrome P450 1A1 and 1B1. Bioorg Med Chem Lett. 2016 Jul 15; 26(14):3243-3247. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.