Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET0KC5P) | |||||
---|---|---|---|---|---|
Name |
Arachidonate 5-lipoxygenase (ALOX5)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
Arachidonate 5-lipoxygenase; 5-LO; 5-lipoxygenase; LOG5
|
||||
Family | Oxidoreductase (ORase) >> Oxygen single donor oxidoreductase (EC 1.13) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | ALOX5 | Gene ID | |||
UniProt ID | LOX5_HUMAN | (click to find more protein-related data of this DBT) | |||
TTD ID | T00140 | (click to find more therapeutic target data of this DBT) | |||
INTEDE ID | DME0201 | (click to find more drug-metabolizing enzyme data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDE
ELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLA RDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVL NYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNG CNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDP CTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDF HVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECG LFDKANATGGGGHVQMVQRAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWE AIRTFTAEVVDIYYEGDQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYL TVVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCW HLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPY YYLSPDRIPNSVAI |
||||
Function |
Catalyzes the first step in leukotriene biosynthesis, and thereby plays a role in inflammatory processes.
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Ethyl isovalerate | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Flavoring agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 35000 nM (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | LOX5_HUMAN | |||||
DIG Name: Propyl gallate | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative; Antioxidant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Ki = 0.43 uM (tested by experiment) | [2] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | LOX5_HUMAN | |||||
DIG Name: Cinnamaldehyde | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Flavoring agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 35000 nM (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | LOX5_HUMAN | |||||
DIG Name: Ethyl vanillate | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Flavoring agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Ki = 270 uM (tested by experiment) | [2] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | LOX5_HUMAN | |||||
DIG Name: Gentisic acid | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Antioxidant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 75000 nM (tested by experiment) | [3] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | LOX5_HUMAN | |||||
DIG Name: Stearic hydrazide | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Emulsifying agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 6000 nM (estimated based on the structural similarity with CHEMBL25790 ) | [4] | ||||
Structural Similarity | Tanimoto coefficient = 0.75 | |||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | LOX5_HUMAN | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.