Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET0KQ6L) | |||||
|---|---|---|---|---|---|
| Name |
Matrix metalloproteinase-1 (MMP1)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Interstitial collagenase; MMP-1; CLG; Fibroblast collagenase; Matrix metalloproteinase-1
|
||||
| Family | Hydrolase (HDase) >> Peptidase (EC 3.4) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | MMP1 | Gene ID | |||
| UniProt ID | MMP1_HUMAN | (click to find more protein-related data of this DBT) | |||
| TTD ID | T52450 | (click to find more therapeutic target data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPV
VEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIEN YTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGN LAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSY TFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDR FYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGY PKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFP GIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN |
||||
| Function |
Cleaves collagens of types VII and X. In case of HIV infection, interacts and cleaves the secreted viral Tat protein, leading to a decrease in neuronal Tat's mediated neurotoxicity. Cleaves collagens of types I, II, and III at one site in the helical domain.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: Aspartame | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
 click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Flavoring agent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 20000 nM (estimated based on the structural similarity with CHEMBL62186 ) | [1] | ||||
| Structural Similarity | Tanimoto coefficient = 0.916666667 | |||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | MMP1_HUMAN | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Inhibition of Matrix Metalloproteinases: An examination of the S1 pocket. Bioorg Med Chem Lett. (1997) 7:193-198. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.