Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET0KR5D)
Name
Trypsin (PRSS)
Synonyms    Click to Show/Hide the Synonyms of This DBT
Cationic trypsinogen; Serine protease; Anionic trypsinogen; Brain trypsinogen; Mesotrypsin; Mesotrypsinogen
Family Hydrolase (HDase)  >>  Peptidase (EC 3.4)
Organism
Homo sapiens (Human)
Gene Name PRSS1 Gene ID
5644
UniProt ID TRY1_HUMAN (click to find more protein-related data of this DBT)
TTD ID T27602 (click to find more therapeutic target data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
Function
Has activity against the synthetic substrates Boc-Phe-Ser-Arg-Mec, Boc-Leu-Thr-Arg-Mec, Boc-Gln-Ala-Arg-Mec and Boc-Val-Pro-Arg-Mec. The single-chain form is more active than the two-chain form against all of these substrates.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Oleic acid Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Penetration agent; Solubilizing agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 > 200000 nM (tested by experiment) [1]
                   Tested Species Sus scrofa (Pig)
                   UniProt ID TRYP_PIG
          DIG Name: Linoleic acid Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Penetration agent; Solubilizing agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 > 200000 nM (tested by experiment) [1]
                   Tested Species Sus scrofa (Pig)
                   UniProt ID TRYP_PIG
References
1 Inhibitory activity of unsaturated fatty acids and anacardic acids toward soluble tissue factor-factor VIIa complex. J Nat Prod. 1998 Nov; 61(11):1352-5.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.