Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET0KS0F) | |||||
---|---|---|---|---|---|
Name |
Serotonin receptor 2B (5HT2B)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
Serotonin 2B receptor; HTR2B; 5-HT 2B receptor; 5-hydroxytryptamine receptor 2B; 5-HT2B; 5-HT-2B; 5-HT 2B
|
||||
Family | G-protein coupled receptor (GPCR) >> G-protein coupled rhodopsin receptor (GPCR-A) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | HTR2B | Gene ID | |||
UniProt ID | 5HT2B_HUMAN | (click to find more protein-related data of this DBT) | |||
TTD ID | T31204 | (click to find more therapeutic target data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHWAALL
ILMVIIPTIGGNTLVILAVSLEKKLQYATNYFLMSLAVADLLVGLFVMPIALLTIMFEAM WPLPLVLCPAWLFLDVLFSTASIMHLCAISVDRYIAIKKPIQANQYNSRATAFIKITVVW LISIGIAIPVPIKGIETDVDNPNNITCVLTKERFGDFMLFGSLAAFFTPLAIMIVTYFLT IHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKALPNSGDET LMRRTSTIGKKSVQTISNEQRASKVLGIVFFLFLLMWCPFFITNITLVLCDSCNQTTLQM LLEIFVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITCNYRATKSVKTLRKRSSKIYFRNP MAENSKFFKKHGIRNGINPAMYQSPMRLRSSTIQSSSIILLDTLLLTENEGDKTEEQVSY V |
||||
Function |
Functions as a receptor for various ergot alkaloid derivatives and psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways.
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: FD&C blue no. 1 | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Colorant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | EC50 > 10 uM (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | 5HT2B_HUMAN | |||||
DIG Name: Chlorocresol | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 1856 nM (estimated based on the structural similarity with CHEMBL398440 ) | [2] | ||||
Structural Similarity | Tanimoto coefficient = 0.928571429 | |||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | 5HT2B_HUMAN | |||||
DIG Name: Thimerosal | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | EC50 = 15 uM (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | 5HT2B_HUMAN | |||||
References | |||||
---|---|---|---|---|---|
1 | The activities of drug inactive ingredients on biological targets. Science. 2020 Jul 24;369(6502):403-413. | ||||
2 | DrugMatrix in vitro pharmacology data. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.