Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET0L3YD) | |||||
|---|---|---|---|---|---|
| Name |
HIF-prolyl hydroxylase 2 (EGLN1)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Hypoxia-inducible factor prolyl hydroxylase 2; C1orf12; Egl nine homolog 1; HIF-PH2; PHD2; HIF-prolyl hydroxylase 2; HPH-2; Prolyl hydroxylase domain-containing protein 2; SM-20
|
||||
| Family | Oxidoreductase (ORase) >> Oxygen paired donor oxidoreductase (EC 1.14) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | EGLN1 | Gene ID | |||
| UniProt ID | EGLN1_HUMAN | (click to find more protein-related data of this DBT) | |||
| TTD ID | T32880 | (click to find more therapeutic target data of this DBT) | |||
| INTEDE ID | DME0462 | (click to find more drug-metabolizing enzyme data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MANDSGGPGGPSPSERDRQYCELCGKMENLLRCSRCRSSFYCCKEHQRQDWKKHKLVCQG
SEGALGHGVGPHQHSGPAPPAAVPPPRAGAREPRKAAARRDNASGDAAKGKVKAKPPADP AAAASPCRAAAGGQGSAVAAEAEPGKEEPPARSSLFQEKANLYPPSNTPGDALSPGGGLR PNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQL VSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMV ACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKF DRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDS VGKDVF |
||||
| Function |
Cellular oxygen sensor that catalyzes, under normoxic conditions, the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. Hydroxylates a specific proline found in each of the oxygen-dependent degradation (ODD) domains (N-terminal, NODD, and C-terminal, CODD) of HIF1A. Also hydroxylates HIF2A. Has a preference for the CODD site for both HIF1A and HIF1B. Hydroxylated HIFs are then targeted for proteasomal degradation via the von Hippel-Lindau ubiquitination complex.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: Fumaric acid | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Acidulant; Antioxidant; Complexing agent; Flavoring agent; Solubilizing agent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 19000 nM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | EGLN1_HUMAN | |||||
| DIG Name: Succinic acid | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Buffering agent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 3000 nM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | EGLN1_HUMAN | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Inhibitor scaffolds for 2-oxoglutarate-dependent histone lysine demethylases. J Med Chem. 2008 Nov 27; 51(22):7053-6. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

