Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET0M9ET) | |||||
|---|---|---|---|---|---|
| Name |
Adipocyte lipid-binding protein (ALBP)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Fatty acid-binding protein 4; Adipocyte fatty binding protein; Adipocyte fatty-acid-binding protein; Adipocyte-type fatty acid-binding protein; Fatty acid-binding protein 4; Fatty acid-binding protein, adipocyte; A-FABP; AFABP; ALBP; FABP4
|
||||
| Family | Other protein families (OPF) >> Fatty acid binding protein (FABP) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | FABP4 | Gene ID | |||
| UniProt ID | FABP4_HUMAN | (click to find more protein-related data of this DBT) | |||
| TTD ID | T07217 | (click to find more therapeutic target data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKN
TEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM KGVTSTRVYERA |
||||
| Function |
Binds both long chain fatty acids and retinoic acid. Delivers long-chain fatty acids and retinoic acid to their cognate receptors in the nucleus. Lipid transport protein in adipocytes.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: Oleic acid | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Penetration agent; Solubilizing agent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Ki = 1500 nM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | FABP4_HUMAN | |||||
| DIG Name: Palmitic acid | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Penetration agent; lubricant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 930 nM (tested by experiment) | [2] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | FABP4_HUMAN | |||||
| DIG Name: Linoleic acid | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Penetration agent; Solubilizing agent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 1000 nM (tested by experiment) | [3] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | FABP4_HUMAN | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

