Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET0NU0W) | |||||
|---|---|---|---|---|---|
| Name |
Cystine/glutamate transporter (SLC7A11)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Amino acid transport system XCT; Amino acid transport system xc-; Calcium channel blocker resistance protein CCBR1; Solute carrier family 7 member 11; X(c)- plasma membrane cystine transporter; X(c)-cystine transporter; XCT
|
||||
| Family | Potential-driven transporter (PDT) >> Amino-polyamine-organocation transporter (APC) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | SLC7A11 | Gene ID | |||
| UniProt ID | XCT_HUMAN | (click to find more protein-related data of this DBT) | |||
| TTD ID | T11615 | (click to find more therapeutic target data of this DBT) | |||
| VARIDT ID | DTD0464 | (click to find more drug transporter data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGA
GIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGP LPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLN SMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFY YGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLS NAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHV RKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRP FKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIM SEKITRTLQIILEVVPEEDKL |
||||
| Function |
Sodium-independent, high-affinity exchange of anionic amino acids with high specificity for anionic form of cystine and glutamate.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: Beta-mercaptoalanine | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Antioxidant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Ki = 59000 nM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | XCT_HUMAN | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Isoxazole analogues bind the system xc- transporter: structure-activity relationship and pharmacophore model. Bioorg Med Chem. 2010 Jan 1; 18(1):202-13. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

