Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET0O4VY) | |||||
---|---|---|---|---|---|
Name |
Liver lipid-binding protein (L-FABP)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
Fatty acid-binding protein 1; L-FABP; Liver-type fatty acid-binding protein; SCP; Squalene- and sterol-carrier protein; Z-protein; p14; Fatty acid-binding protein, liver; FABP1
|
||||
Family | Other protein families (OPF) >> Fatty acid binding protein (FABP) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | FABP1 | Gene ID | |||
UniProt ID | FABPL_HUMAN | (click to find more protein-related data of this DBT) | |||
TTD ID | T73712 | (click to find more therapeutic target data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQ
NEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVF KRISKRI |
||||
Function |
Plays a role in lipoprotein-mediated cholesterol uptake in hepatocytes. Binds cholesterol. Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport.
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Oleic acid | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Penetration agent; Solubilizing agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Ki = 180 nM (tested by experiment) | [1] | ||||
Tested Species | Rattus norvegicus (Rat) | |||||
UniProt ID | FABPL_RAT | |||||
References | |||||
---|---|---|---|---|---|
1 | Characterization of the drug binding specificity of rat liver fatty acid binding protein. J Med Chem. 2008 Jul 10; 51(13):3755-64. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.