Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET0OS9A) | |||||
---|---|---|---|---|---|
Name |
Deacetylase sirtuin-5 (SIRT5)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
NAD-dependent deacetylase sirtuin-5; NAD-dependent protein deacetylase sirtuin-5; Regulatory protein SIR2 homolog 5; SIR2-like protein 5; SIR2L5
|
||||
Family | Transferase (TFase) >> Acyltransferase (EC 2.3) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | SIRT5 | Gene ID | |||
UniProt ID | SIR5_HUMAN | (click to find more protein-related data of this DBT) | |||
TTD ID | T91940 | (click to find more therapeutic target data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAG
VSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRA IAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPI CPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELA HCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEA LACHENETVS |
||||
Function |
NAD-dependent lysine demalonylase, desuccinylase and deglutarylase that specifically removes malonyl, succinyl and glutaryl groups on target proteins. Activates CPS1 and contributes to the regulation of blood ammonia levels during prolonged fasting: acts by mediating desuccinylation and deglutarylation of CPS1, thereby increasing CPS1 activity in response to elevated NAD levels during fasting. Activates SOD1 by mediating its desuccinylation, leading to reduced reactive oxygen species.
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Niacinamide | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Antioxidant; Solubilizing agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 > 100000 nM (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | SIR5_HUMAN | |||||
References | |||||
---|---|---|---|---|---|
1 | A FRET-based assay for screening SIRT5 specific modulators. Bioorg Med Chem Lett. 2015 Apr 15; 25(8):1671-1674. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.