Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET0R8AW)
Name
Sodium/bile acid cotransporter (SLC10A1)
Synonyms    Click to Show/Hide the Synonyms of This DBT
Cell growth-inhibiting gene 29 protein; Na(+)/bile acid cotransporter; Na(+)/taurocholate transport protein; Sodium/taurocholate cotransporting polypeptide; Solute carrier family 10 member 1
Family Potential-driven transporter (PDT)  >>  Bile acid:sodium symporter (BASS)
Organism
Homo sapiens (Human)
Gene Name SLC10A1 Gene ID
6554
UniProt ID NTCP_HUMAN (click to find more protein-related data of this DBT)
TTD ID T99189 (click to find more therapeutic target data of this DBT)
VARIDT ID DTD0019 (click to find more drug transporter data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MEAHNASAPFNFTLPPNFGKRPTDLALSVILVFMLFFIMLSLGCTMEFSKIKAHLWKPKG
LAIALVAQYGIMPLTAFVLGKVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSI
VMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKR
PQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVL
SALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLGEGLLL
IAIFWCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA
Function
The hepatic sodium/bile acid uptake system exhibits broad substrate specificity and transports various non-bile acid organic compounds as well. It is strictly dependent on the extracellular presence of sodium.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Polyoxyl 35 castor oil Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Solubilizing agent; Surfactant
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 2.8 %(w/v) (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID NTCP_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 0.012 %(w/v) (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID NTCP_HUMAN
          DIG Name: Hydroxyethyl-beta-cyclodextrin Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Other agent
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 0.52 %(w/v) (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID NTCP_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 4.6 %(w/v) (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID NTCP_HUMAN
          DIG Name: Polyoxyl 15 hydroxystearate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Solubilizing agent; Surfactant
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 1.5 %(w/v) (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID NTCP_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 0.0058 %(w/v) (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID NTCP_HUMAN
References
1 Pharmaceutical excipients influence the function of human uptake transporting proteins. Mol Pharm. 2012 Sep 4;9(9):2577-81.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.