General Information of DBT (ID: ET0RM1V)
Name
Guanine-binding G(o) alpha (GNAO1)
Synonyms    Click to Show/Hide the Synonyms of This DBT
Guanine nucleotide-binding protein G(o) subunit alpha; G protein subunit alpha o1; GNAO1
Family Other protein families (OPF)  >>  G-alpha protein (GAP)
Organism
Homo sapiens (Human)
Gene Name GNAO1 Gene ID
2775
UniProt ID GNAO_HUMAN (click to find more protein-related data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDG
FSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPF
SAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRV
KTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDET
TNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYTGPNTYEDA
AAYIQAQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY
Function
Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(o) protein function is not clear. Stimulated by RGS14.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Hexetidine Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 24300 nM (estimated based on the structural similarity with CHEMBL541892 ) [1]
                   Structural Similarity Tanimoto coefficient = 0.79245283
                   Tested Species Homo sapiens (Human)
                   UniProt ID GNAO_HUMAN
          DIG Name: Stearic hydrazide Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 23400 nM (estimated based on the structural similarity with CHEMBL3215538 ) [1]
                   Structural Similarity Tanimoto coefficient = 0.75
                   Tested Species Homo sapiens (Human)
                   UniProt ID GNAO_HUMAN
References
1 Design, synthesis, and preliminary pharmacological evaluation of a set of small molecules that directly activate gi proteins. J Med Chem. 2005 Oct 6; 48(20):6491-503.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.