Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET0SS7L) | |||||
|---|---|---|---|---|---|
| Name |
Glutamate/aspartate transporter 1 (GLAST1)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Excitatory amino acid transporter 1; EAAT1; GLAST-1; Sodium-dependent glutamate/aspartate transporter 1; Solute carrier family 1 member 3
|
||||
| Family | Potential-driven transporter (PDT) >> Dicarboxylate/amino acid:cation symporter (DAACS) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | SLC1A3 | Gene ID | |||
| UniProt ID | EAA1_HUMAN | (click to find more protein-related data of this DBT) | |||
| TTD ID | T86582 | (click to find more therapeutic target data of this DBT) | |||
| VARIDT ID | DTD0131 | (click to find more drug transporter data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MTKSNGEEPKMGGRMERFQQGVRKRTLLAKKKVQNITKEDVKSYLFRNAFVLLTVTAVIV
GTILGFTLRPYRMSYREVKYFSFPGELLMRMLQMLVLPLIISSLVTGMAALDSKASGKMG MRAVVYYMTTTIIAVVIGIIIVIIIHPGKGTKENMHREGKIVRVTAADAFLDLIRNMFPP NLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPGSVNG VNALGLVVFSMCFGFVIGNMKEQGQALREFFDSLNEAIMRLVAVIMWYAPVGILFLIAGK IVEMEDMGVIGGQLAMYTVTVIVGLLIHAVIVLPLLYFLVTRKNPWVFIGGLLQALITAL GTSSSSATLPITFKCLEENNGVDKRVTRFVLPVGATINMDGTALYEALAAIFIAQVNNFE LNFGQIITISITATAASIGAAGIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWFLDRLRT TTNVLGDSLGAGIVEHLSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSET KM |
||||
| Function |
Sodium-dependent, high-affinity amino acid transporter that mediates the uptake of L-glutamate and also L-aspartate and D-aspartate. Functions as a symporter that transports one amino acid molecule together with two or three Na(+) ions and one proton, in parallel with the counter-transport of one K(+) ion. Mediates Cl(-) flux that is not coupled to amino acid transport; this avoids the accumulation of negative charges due to aspartate and Na(+) symport.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: Glutamic acid hydrochloride | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Acidulant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 11000 nM (estimated based on the structural similarity with CHEMBL575060 ) | [1] | ||||
| Structural Similarity | Tanimoto coefficient = 1 | |||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | EAA1_HUMAN | |||||
| DIG Name: Aspartic acid | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Vaccine adjuvant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 9300 nM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | EAA1_HUMAN | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

