Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET0SZ6G) | |||||
---|---|---|---|---|---|
Name |
Solute carrier SLCO1A2 (OATP-A)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
Sodium-independent organic anion transporter; OATP; OATP-1; OATP-A; OATP1A2; Organic anion-transporting polypeptide 1; SLC21A3; Sodium-independent organic anion transporter; Solute carrier family 21 member 3; Solute carrier organic anion transporter family member 1A2
|
||||
Family | Potential-driven transporter (PDT) >> Organo anion transporter (OAT) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | SLCO1A2 | Gene ID | |||
UniProt ID | SO1A2_HUMAN | (click to find more protein-related data of this DBT) | |||
TTD ID | T00569 | (click to find more therapeutic target data of this DBT) | |||
VARIDT ID | DTD0029 | (click to find more drug transporter data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MGETEKRIETHRIRCLSKLKMFLLAITCAFVSKTLSGSYMNSMLTQIERQFNIPTSLVGF
INGSFEIGNLLLIIFVSYFGTKLHRPIMIGIGCVVMGLGCFLKSLPHFLMNQYEYESTVS VSGNLSSNSFLCMENGTQILRPTQDPSECTKEVKSLMWVYVLVGNIVRGMGETPILPLGI SYIEDFAKFENSPLYIGLVETGAIIGPLIGLLLASFCANVYVDTGFVNTDDLIITPTDTR WVGAWWFGFLICAGVNVLTAIPFFFLPNTLPKEGLETNADIIKNENEDKQKEEVKKEKYG ITKDFLPFMKSLSCNPIYMLFILVSVIQFNAFVNMISFMPKYLEQQYGISSSDAIFLMGI YNLPPICIGYIIGGLIMKKFKITVKQAAHIGCWLSLLEYLLYFLSFLMTCENSSVVGINT SYEGIPQDLYVENDIFADCNVDCNCPSKIWDPVCGNNGLSYLSACLAGCETSIGTGINMV FQNCSCIQTSGNSSAVLGLCDKGPDCSLMLQYFLILSAMSSFIYSLAAIPGYMVLLRCMK SEEKSLGVGLHTFCTRVFAGIPAPIYFGALMDSTCLHWGTLKCGESGACRIYDSTTFRYI YLGLPAALRGSSFVPALIILILLRKCHLPGENASSGTELIETKVKGKENECKDIYQKSTV LKDDELKTKL |
||||
Function |
Mediates the Na(+)-independent transport of organic anions such as sulfobromophthalein (BSP) and conjugated (taurocholate) and unconjugated (cholate) bile acids. Selectively inhibited by the grapefruit juice component naringin.
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Polyethylene glycol 400 | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Coating agent; Diluent; Ointment base; Plasticizing agent; Solvent; Suppository base; lubricant
|
|||||
Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 0.14 %(w/v) (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | SO1A2_HUMAN | |||||
Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 0.05 %(w/v) (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | SO1A2_HUMAN | |||||
DIG Name: Polyoxyl 35 castor oil | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Solubilizing agent; Surfactant
|
|||||
Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 0.00054 %(w/v) (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | SO1A2_HUMAN | |||||
Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 0.00034 %(w/v) (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | SO1A2_HUMAN | |||||
DIG Name: Hydroxyethyl-beta-cyclodextrin | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Other agent
|
|||||
Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 0.027 %(w/v) (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | SO1A2_HUMAN | |||||
Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 0.025 %(w/v) (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | SO1A2_HUMAN | |||||
DIG Name: Polyoxyl 15 hydroxystearate | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Solubilizing agent; Surfactant
|
|||||
Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 0.0074 %(w/v) (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | SO1A2_HUMAN | |||||
Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 0.0041 %(w/v) (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | SO1A2_HUMAN | |||||
References | |||||
---|---|---|---|---|---|
1 | Pharmaceutical excipients influence the function of human uptake transporting proteins. Mol Pharm. 2012 Sep 4;9(9):2577-81. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.