Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET0TB7Z) | |||||
|---|---|---|---|---|---|
| Name |
Glutamate receptor kainate 2 (GRIK2)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Glutamate receptor ionotropic, kainate 2; EAA4; Excitatory amino acid receptor 4; GluK2; GluR-6; GluR6; Glutamate receptor 6
|
||||
| Family | Transmembrane channel/porin (TC/P) >> Glutamate-gated ion channel (GIC) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | GRIK2 | Gene ID | |||
| UniProt ID | GRIK2_HUMAN | (click to find more protein-related data of this DBT) | |||
| TTD ID | T58178 | (click to find more therapeutic target data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MKIIFPILSNPVFRRTVKLLLCLLWIGYSQGTTHVLRFGGIFEYVESGPMGAEELAFRFA
VNTINRNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQS ICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDST GLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILK QALAMGMMTEYYHYIFTTLDLFALDVEPYRYSGVNMTGFRILNTENTQVSSIIEKWSMER LQAPPKPDSGLLDGFMTTDAALMYDAVHVVSVAVQQFPQMTVSSLQCNRHKPWRFGTRFM SLIKEAHWEGLTGRITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTESQKGK PANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEI RLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISI LYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSD VVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLT VERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKS NEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITI AILQLQEEGKLHMMKEKWWRGNGCPEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVG EFLYKSKKNAQLEKRSFCSAMVEELRMSLKCQRRLKHKPQAPVIVKTEEVINMHTFNDRR LPGKETMA |
||||
| Function |
L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: Glutamic acid hydrochloride | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Acidulant
|
|||||
| Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Ki = 1106 nM (estimated based on the structural similarity with CHEMBL575060 ) | [1] | ||||
| Structural Similarity | Tanimoto coefficient = 1 | |||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | GRIK2_HUMAN | |||||
| Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Ki = 330 nM (estimated based on the structural similarity with CHEMBL575060 ) | [2] | ||||
| Structural Similarity | Tanimoto coefficient = 1 | |||||
| Tested Species | Rattus norvegicus (Rat) | |||||
| UniProt ID | GRIK2_RAT | |||||
| DIG Name: Monosodium glutamate | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Buffering agent; Flavoring agent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | EC50 = 25000 nM (estimated based on the structural similarity with CHEMBL575060 ) | [3] | ||||
| Structural Similarity | Tanimoto coefficient = 0.979166667 | |||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | GRIK2_HUMAN | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

