Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET0U9ZS) | |||||
---|---|---|---|---|---|
Name |
Protein-tyrosine phosphatase 1B (PTPN1)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
Protein-tyrosine phosphatase 1B; Tyrosine-protein phosphatase non-receptor type 1; PTP-1B; PTPase 1
|
||||
Family | Hydrolase (HDase) >> Ester bond hydrolase (EC 3.1) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | PTPN1 | Gene ID | |||
UniProt ID | PTN1_HUMAN | (click to find more protein-related data of this DBT) | |||
TTD ID | T16347 | (click to find more therapeutic target data of this DBT) | |||
INTEDE ID | DME0495 | (click to find more drug-metabolizing enzyme data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLH
QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLK CAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWP DFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLE PPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYG IESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLT AGAYLCYRFLFNSNT |
||||
Function |
Mediates dephosphorylation of EIF2AK3/PERK; inactivating the protein kinase activity of EIF2AK3/PERK. May play an important role in CKII- and p60c-src-induced signal transduction cascades. May regulate the EFNA5-EPHA3 signaling pathway which modulates cell reorganization and cell-cell repulsion. May also regulate the hepatocyte growth factor receptor signaling pathway through dephosphorylation of MET. Tyrosine-protein phosphatase which acts as a regulator of endoplasmic reticulum unfolded protein response.
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Allura red AC dye | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Colorant
|
|||||
Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 33000 nM (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | PTN1_HUMAN | |||||
Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 410000 nM (tested by experiment) | [1] | ||||
Tested Species | Saccharomyces cerevisiae (Yeast) | |||||
UniProt ID | PTP1_YEAST | |||||
DIG Name: Carminic acid | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Colorant
|
|||||
Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 26000 nM (estimated based on the structural similarity with CHEMBL1366408 ) | [1] | ||||
Structural Similarity | Tanimoto coefficient = 1 | |||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | PTN1_HUMAN | |||||
Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 15000 nM (estimated based on the structural similarity with CHEMBL1366408 ) | [1] | ||||
Structural Similarity | Tanimoto coefficient = 1 | |||||
Tested Species | Saccharomyces cerevisiae (Yeast) | |||||
UniProt ID | PTP1_YEAST | |||||
DIG Name: FD&C red no. 4 | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Colorant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 1200 nM (estimated based on the structural similarity with CHEMBL1200712 ) | [1] | ||||
Structural Similarity | Tanimoto coefficient = 0.863387978 | |||||
Tested Species | Saccharomyces cerevisiae (Yeast) | |||||
UniProt ID | PTP1_YEAST | |||||
DIG Name: Gentisic acid | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Antioxidant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 > 100000 nM (tested by experiment) | [2] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | PTN1_HUMAN | |||||
DIG Name: Glycyrrhizin | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Flavoring agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 > 100000 nM (tested by experiment) | [3] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | PTN1_HUMAN | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.