Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET0UC8K) | |||||
---|---|---|---|---|---|
Name |
Deacetylase sirtuin-2 (SIRT2)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
NAD-dependent deacetylase sirtuin-2; NAD-dependent protein deacetylase sirtuin-2; NADdependent protein deacetylase sirtuin2; Regulatory protein SIR2 homolog 2; SIR2-like protein 2; SIR2L; SIR2L2; SIR2like protein 2
|
||||
Family | Transferase (TFase) >> Acyltransferase (EC 2.3) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | SIRT2 | Gene ID | |||
UniProt ID | SIR2_HUMAN | (click to find more protein-related data of this DBT) | |||
TTD ID | T83904 | (click to find more therapeutic target data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MAEPDPSHPLETQAGKVQEAQDSDSDSEGGAAGGEADMDFLRNLFSQTLSLGSQKERLLD
ELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFE ISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQ EDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLP ARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGMI MGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQSGAGV PNPSTSASPKKSPPPAKDEARTTEREKPQ |
||||
Function |
Participates in the modulation of multiple and diverse biological processes such as cell cycle control, genomic integrity, microtubule dynamics, cell differentiation, metabolic networks, and autophagy. Plays a major role in the control of cell cycle progression and genomic stability. Functions in the antephase checkpoint preventing precocious mitotic entry in response to microtubule stress agents, and hence allowing proper inheritance of chromosomes.
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Niacinamide | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Antioxidant; Solubilizing agent
|
|||||
Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 1200 nM (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | SIR2_HUMAN | |||||
Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 < 50000 nM (tested by experiment) | [2] | ||||
Tested Species | Saccharomyces cerevisiae (Yeast) | |||||
UniProt ID | SIR2_YEAST | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.